Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:CLEANChemicals
Clear all filters
NITI Aayog begins consultations on implementing SHANTI Act
positive
ET Markets - Industry 4h ago

NITI Aayog begins consultations on implementing SHANTI Act

NITI Aayog convened a consultation on the SHANTI Act, 2025, allowing private nuclear energy plant ownership. Discussions focused on draft rules, regulations, and FDI policy provisions for the new law. Stakeholders examined financial mechanisms and risk mitigation frameworks for project support. The Act aims to modernize nuclear laws and boost clean energy transition. It also strengthens regulatory oversight and domestic manufacturing capabilities for nuclear projects.

CLEANCLEANMAXENERGYGKENERGYJMFINANCILKPELRPPINFRASHANTIChemicalsConstruction
India's non-fossil fuel-based energy capacity rises 22% to 297.36 GW in June
positive
ET Markets - Industry 1d ago

India's non-fossil fuel-based energy capacity rises 22% to 297.36 GW in June

India's non-fossil fuel energy capacity reached 297.36 GW in June. This represents a significant year-on-year increase of over twenty-two percent. Solar energy capacity grew substantially to 162.15 GW from 116.25 GW. Wind energy also saw an increase, contributing to the overall clean energy expansion. The nation continues its accelerated progress towards ambitious clean energy goals.

CLEANCLEANMAXENERGYGKENERGYKPELSOLARINDSChemicalsConstruction
NEWS
neutral
Business Standard - Markets 1d ago

Adani Enterprises partners with French clean-technology company Dioxycle

To advance low-carbon chemical production in India

ADANIENTADVANCECHEMICALCLEANChemicalsFinancial Services
World Bank Group commits $890 million to promote solar rooftop project in India
positive
ET Markets - Industry 1d ago

World Bank Group commits $890 million to promote solar rooftop project in India

The World Bank committed USD 890 million for India's solar rooftop initiative. This funding aims to bring clean energy to millions of homes nationwide. The program will also create significant job opportunities across the renewable energy sector. India seeks to achieve net zero emissions by 2070 and increase non-fossil fuels. This support will help scale residential solar and reduce household electricity costs.

BANKINDIACLEANCLEANMAXCOMMITTEDENERGYGKENERGYIREDAKPELSOLARINDSSWSOLARChemicalsConstruction
India's growth riding on copper, govt should help boost capacity, industry body says
positive
ET Markets - Industry 1d ago

India's growth riding on copper, govt should help boost capacity, industry body says

India's infrastructure boom fuels copper demand growth significantly higher than GDP. Copper demand is projected to rise nine to ten percent annually. This surge is driven by infrastructure, clean energy, and consumer electronics needs. India has become a net importer of copper after a smelter closure. New capacities are emerging, but a deficit is still expected.

CLEANCLEANMAXCONSUMERENERGYGKENERGYKPELLGEINDIAChemicalsConstruction
Premier Energies commissions 5.6 GW solar module plant in Telangana
positive
ET Markets - Industry 2d ago

Premier Energies commissions 5.6 GW solar module plant in Telangana

Premier Energies commissioned a significant 5.6 GW solar module facility in Telangana. The company also began construction for a 6 GWh battery storage system. This expansion increases Premier Energies' module manufacturing capacity to 11.1 GW. These new projects aim to strengthen India's clean-energy ecosystem and supply chain. The company is also investing heavily to become an integrated solar manufacturer.

ATCENERGYBMETRICSCLEANCLEANMAXENERGYGENCONGKENERGYKPELPREMIERPREMIERENERPPINFRASOLARINDSTVSSCSWEBELSOLARCapital GoodsChemicals
NITI Aayog holds stakeholder consultation on critical mineral demand, supply chain security amid rising clean energy needs
positive
ET Markets - Industry 2d ago

NITI Aayog holds stakeholder consultation on critical mineral demand, supply chain security amid rising clean energy needs

NITI Aayog convened experts to assess India's future critical mineral needs. Discussions focused on demand, supply chain vulnerabilities, and domestic capabilities. India's clean energy and advanced manufacturing expansion will drive mineral demand. The nation faces import dependency, requiring supply source diversification and domestic value chains. These efforts aim to secure long-term economic and national security objectives.

BMETRICSCLEANCLEANMAXENERGYFELFELDVRGKENERGYKPELLTGILTBEESTVSSCSVALUEChemicalsConstruction
Himadri-backed Sicona secures AUD 45 million ARENA funding for battery technology
positive
ET Markets - Industry 4d ago

Himadri-backed Sicona secures AUD 45 million ARENA funding for battery technology

Sicona Battery Technologies secured significant funding for its advanced battery materials. This investment will build a commercial-scale demonstration facility in New South Wales. The new plant will produce silicon-carbon anode material for electric vehicles. This technology promises increased battery energy density and faster charging speeds. Himadri Speciality Chemical's stake in Sicona strengthens its clean energy strategy.

BFINVESTCHEMICALCLEANCLEANMAXENERGYGKENERGYHSCLINNOMETKPELPARAGONSPECIALITYVICTORYEVAutomobile and Auto ComponentsChemicals
Protein & clean labels priorities in snacking; quick commerce fuelling healthy snacking: Farmley report
positive
ET Markets - Industry 4d ago

Protein & clean labels priorities in snacking; quick commerce fuelling healthy snacking: Farmley report

Indian consumers now prioritize protein content and natural sweeteners in their snack selections. Quick commerce and ingredient transparency are reshaping how brands are discovered and trusted. Parents are willing to pay more for healthier snack options for their children. Women are seeking snacks tailored for period nutrition, creating new wellness opportunities. Packaging convenience and sustainability are increasingly influencing consumer purchase decisions.

CLEANCONSUMERHEALTHYChemicalsFinancial Services
NEWS
positive
Business Standard - Markets 4d ago

Clean Max Enviro Energy Solutions commissions 530 MW renewable energy capacity in Q1 FY27

Total operational renewable energy portfolio now stands at 4.2 GW

CLEANCLEANMAXENERGYENVIROGKENERGYIREDAKPELMAXINDSWSOLARTOTALCapital GoodsChemicals
Private banks write off nearly half of NPAs in FY26, outpace PSBs
neutral
ET Markets - Industry 4d ago

Private banks write off nearly half of NPAs in FY26, outpace PSBs

"Private banks utilise these write-offs and provisioning buffers to proactively clean up their balance sheets, while public sector banks generally rely more heavily on aggregate long-term or systemic recovery," said Kuntal Sur, partner and leader for risk consulting, financial services and treasury, at PwC India. "Unsecured retail loans in general have shown deteriorations leading to higher write-offs."

CLEANJMFINANCILLTGILTBEESRETAILSDREAMSV2RETAILChemicalsConsumer Services
Private banks write off nearly half of NPAs in FY26, outpace PSBs
neutral
ET Markets - Stocks 4d ago

Private banks write off nearly half of NPAs in FY26, outpace PSBs

"Private banks utilise these write-offs and provisioning buffers to proactively clean up their balance sheets, while public sector banks generally rely more heavily on aggregate long-term or systemic recovery," said Kuntal Sur, partner and leader for risk consulting, financial services and treasury, at PwC India. "Unsecured retail loans in general have shown deteriorations leading to higher write-offs."

CLEANJMFINANCILLTGILTBEESRETAILSDREAMSV2RETAILChemicalsConsumer Services
Next