Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:BMETRICSConstruction
Clear all filters
ONGC to undertake 1.75 MMT strategic oil reserve expansion at Mangaluru
positive
ET Markets - Industry 1d ago

ONGC to undertake 1.75 MMT strategic oil reserve expansion at Mangaluru

ONGC approved a 1.75 MMT strategic petroleum reserve expansion at Mangaluru. This project will add significant storage capacity to India's energy security network. India is strengthening its reserves after recent global supply chain disruptions. Additional SPR facilities are also being developed in Odisha and Karnataka. This increases India's total oil storage capacity to approximately seventy-four days.

BMETRICSENERGYGKENERGYGLOBALKPELOILONGCTOTALTVSSCSConstructionConsumer Services
Premier Energies commissions 5.6 GW solar module plant in Telangana
positive
ET Markets - Industry 2d ago

Premier Energies commissions 5.6 GW solar module plant in Telangana

Premier Energies commissioned a significant 5.6 GW solar module facility in Telangana. The company also began construction for a 6 GWh battery storage system. This expansion increases Premier Energies' module manufacturing capacity to 11.1 GW. These new projects aim to strengthen India's clean-energy ecosystem and supply chain. The company is also investing heavily to become an integrated solar manufacturer.

ATCENERGYBMETRICSCLEANCLEANMAXENERGYGENCONGKENERGYKPELPREMIERPREMIERENERPPINFRASOLARINDSTVSSCSWEBELSOLARCapital GoodsChemicals
NITI Aayog holds stakeholder consultation on critical mineral demand, supply chain security amid rising clean energy needs
positive
ET Markets - Industry 2d ago

NITI Aayog holds stakeholder consultation on critical mineral demand, supply chain security amid rising clean energy needs

NITI Aayog convened experts to assess India's future critical mineral needs. Discussions focused on demand, supply chain vulnerabilities, and domestic capabilities. India's clean energy and advanced manufacturing expansion will drive mineral demand. The nation faces import dependency, requiring supply source diversification and domestic value chains. These efforts aim to secure long-term economic and national security objectives.

BMETRICSCLEANCLEANMAXENERGYFELFELDVRGKENERGYKPELLTGILTBEESTVSSCSVALUEChemicalsConstruction
PS5 runs out faster on GTA VI rush amid demand to upgrade consoles
positive
ET Markets - Industry 7d ago

PS5 runs out faster on GTA VI rush amid demand to upgrade consoles

The highly anticipated Grand Theft Auto VI pre-orders have ignited a frenzy for PlayStation 5 consoles, with stock vanishing rapidly. Retailers report PS5s selling out within days, driven by the game's exclusive launch on current-gen consoles and Sony's strong marketing push. This surge, impacting all sales channels, shows the immense gamer demand clashing with ongoing supply chain issues.

ALLETECAMBAAUTOBMETRICSCURRENTTVSSCSAutomobile and Auto ComponentsConstruction
Hitachi Energy Confident Of 'Level Playing Field' As Govt Allows Select Chinese Firms In Power Bids
positive
NDTV Profit 8d ago

Hitachi Energy Confident Of 'Level Playing Field' As Govt Allows Select Chinese Firms In Power Bids

Commenting on the decision, Venu said it reflects the realities of India's rapidly expanding renewable energy ecosystem and the supply chain disruptions witnessed in recent years.

BMETRICSDPELENERGYGKENERGYGVPILIREDAKPELPOWERINDIASERVOTECHSWSOLARTVSSCSCapital GoodsConstruction
Raymond’s aerospace vertical growth outpaces precision engineering business
positive
LiveMint - Companies 13d ago

Raymond’s aerospace vertical growth outpaces precision engineering business

Driven by global supply-chain diversification, JK Maini Global Aerospace is clocking a 25% expansion rate and has locked in a ₹2,350-crore order pipeline over the next five years.

AONELIQUIDBMETRICSCASHIETFFIVESTARGALAPRECGLOBALHDFCLIQUIDHGINFRALIQGRWBEESLIQUIDBETFLIQUIDPLUSMBELPRECISIONRATNAVEERRAYMONDSBILIQETFTVSSCSAutomobile and Auto ComponentsCapital Goods
At Sid’s Farm, the pursuit of milk begins with uncompromising standards
positive
ET Markets - Industry 15d ago

At Sid’s Farm, the pursuit of milk begins with uncompromising standards

Sid's Farm is strengthening consumer trust through rigorous daily quality checks and a parent-first approach to dairy production. The company invests over ₹15 lakh every month in antibiotic residue testing while rewarding farmers for maintaining quality standards. Its #HoldUsToIt campaign encourages consumers to question and verify its practices, promoting transparency over traditional brand promises. By aligning supply-chain integrity with food safety, Sid’s Farm aims to set a new benchmark for trust in India's dairy sector.

BMETRICSCONSUMERINTEGRITYTRUSTTVSSCSConstructionFinancial Services
Govt targets solar, hydrogen components to cut import dependence
positive
ET Markets - Industry 16d ago

Govt targets solar, hydrogen components to cut import dependence

India is boosting domestic manufacturing across solar, green hydrogen, and wind energy sectors to curb import reliance. Key focus areas include solar inverters, electrodes, catalysts, bipolar plates, and polysilicon. This strategic move aims to strengthen the supply chain for critical components, addressing current import dependencies and fostering long-term cost competitiveness for India's burgeoning renewable energy industry.

ADANIGREENBMETRICSCURRENTENERGYFOCUSGKENERGYINOXGREENIREDAKPELKPIGREENLTGILTBEESNTPCGREENRELIANCERELINFRASAATVIKGLSOLARINDSSWSOLARTVSSCSCapital GoodsChemicals
Motilal Oswal initiates coverage on KPR Mill, 7 other textile stocks with up to 43% upside. Own any?
positive
ET Markets - Stocks 17d ago

Motilal Oswal initiates coverage on KPR Mill, 7 other textile stocks with up to 43% upside. Own any?

Motilal Oswal has initiated coverage on eight textile companies, turning bullish on Gokaldas Exports, Indo Count, Arvind Fashions, Pearl Global and Welspun Living. The brokerage expects improving global demand, trade agreements and supply-chain shifts to support India’s textile sector recovery and long-term export growth.

ARVINDARVINDFASNBMETRICSGLOBALGOKEXICILKPRMILLLTGILTBEESMOALPHA50MOBANK10MOCAPITALMODEFENCEMOENERGYMOGOLDMOGSECMOHEALTHMOINFRAMOIPOMOLOWVOLMOM100MOM50MOMENTUM50MOMGFMOMIDMTMMOMNCMOMOMENTUMMON100MON50EQUALMONEXT50MONIFTY100MONIFTY500MONQ50MOPSEMOQUALITYMOREALTYMOSERVICEMOSILVERMOSMALL250MOTILALOFSMOTOURMOVALUEPGILTVSSCSWELCORPWELENTWELSPUNLIVCapital GoodsConstruction
India needs to diversify its sources of energy needs, says NITI vice-chairman
positive
ET Markets - Industry 18d ago

India needs to diversify its sources of energy needs, says NITI vice-chairman

NITI Aayog Vice Chairman Ashok Kumar Lahiri highlighted that the West Asia conflict, though a temporary supply chain issue, underscores India's need to diversify energy sources. He expressed optimism about an upcoming India-US trade agreement and advocated for including pharmaceutical products in future FTAs. Lahiri likened the crisis to a manageable 'influenza,' emphasizing the lesson of not concentrating all import and export dependencies.

ALLETECBMETRICSENERGYFELFELDVRGKENERGYKPELSKMEGGPRODTVSSCSConstructionConsumer Services
India aims to reach 155 GW of installed wind energy capacity by 2035: Union minister Joshi
positive
ET Markets - Industry 26d ago

India aims to reach 155 GW of installed wind energy capacity by 2035: Union minister Joshi

India is targeting 100 gigawatts of wind energy by 2030 and 155 gigawatts by 2035. A new digital portal, WT-MARUT, has been launched to strengthen the wind turbine supply chain. This initiative will boost domestic manufacturing and enhance India's global competitiveness. The country is already a major player, with significant growth in wind power installations.

BMETRICSDPELENERGYGKENERGYGLOBALGVPILKPELTVSSCSCapital GoodsConstruction
HVR Solar signs global MoUs to set up 1.2 GW TOPCon solar cell manufacturing facility in Uttar Pradesh
positive
ET Markets - Industry 29d ago

HVR Solar signs global MoUs to set up 1.2 GW TOPCon solar cell manufacturing facility in Uttar Pradesh

HVR Solar Ltd is establishing a 1.2 GW TOPCon solar cell manufacturing line in Uttar Pradesh through strategic MoUs signed at SNEC PV Power Expo 2026. Partnering with global technology providers, the facility aims to boost India's domestic renewable energy supply chain, reduce import reliance, and create over 500 local jobs.

BMETRICSDPELENERGYGKENERGYGLOBALGVPILIREDAKPELRELIANCERELINFRARPOWERSERVOTECHSOLARINDSSWSOLARTVSSCSCapital GoodsChemicals
Next