Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:CONSUMERConstruction
Clear all filters
Nearly 210 new-age firms ready for public markets in next 2 years: Redseer
positive
Business Standard - Markets 1d ago

Nearly 210 new-age firms ready for public markets in next 2 years: Redseer

Redseer projects nearly 210 new-age firms will be ready for IPOs over the next two years, with listed companies' market capitalisation expected to reach $1 trillion by 2030

CONSUMEREVIETFEVINDIAGROWWEVRPPINFRAConstructionFinancial Services
India's growth riding on copper, govt should help boost capacity, industry body says
positive
ET Markets - Industry 1d ago

India's growth riding on copper, govt should help boost capacity, industry body says

India's infrastructure boom fuels copper demand growth significantly higher than GDP. Copper demand is projected to rise nine to ten percent annually. This surge is driven by infrastructure, clean energy, and consumer electronics needs. India has become a net importer of copper after a smelter closure. New capacities are emerging, but a deficit is still expected.

CLEANCLEANMAXCONSUMERENERGYGKENERGYKPELLGEINDIAChemicalsConstruction
Tata Consumer Share Price Live Updates: Tata Consumer's Current Price
positive
ET Markets - Stocks 2d ago

Tata Consumer Share Price Live Updates: Tata Consumer's Current Price

CONSUMERCURRENTTATACONSUMTATATECHConstructionFast Moving Consumer Goods
Eternal shares could hit new record highs, Motilal Oswal projects backed by these factors
positive
CNBC TV18 - Markets 4d ago

Eternal shares could hit new record highs, Motilal Oswal projects backed by these factors

As Eternal expands beyond food and quick commerce into the wallet share of the affluent urban consumer, Motilal Oswal believes District presents meaningful optionality and could contribute $125 million to its EBITDA by FY30.

CONSUMERETERNALMOALPHA50MOBANK10MOCAPITALMODEFENCEMOENERGYMOGOLDMOGSECMOHEALTHMOINFRAMOIPOMOLOWVOLMOM100MOM50MOMENTUM50MOMGFMOMIDMTMMOMNCMOMOMENTUMMON100MON50EQUALMONEXT50MONIFTY100MONIFTY500MONQ50MOPSEMOQUALITYMOREALTYMOSERVICEMOSILVERMOSMALL250MOTILALOFSMOTOURMOVALUERPPINFRAURBANURBANCOConstructionConsumer Services
Godrej Consumer expects high-teens Q1 revenue growth on strong volumes; margins seen lower
positive
LiveMint - Markets 8d ago

Godrej Consumer expects high-teens Q1 revenue growth on strong volumes; margins seen lower

Godrej Consumer Products projects a high-teens revenue growth for Q1 FY27, supported by robust volume increases across all categories. 

ALLETECCONSUMERGANESHCPGODREJCPGODREJINDJUBLCPLLIBASRPPINFRATATACONSUMChemicalsConstruction
NEWS
positive
Business Standard - Markets 10d ago

Adani Green Energy achieves 20 GW renewable milestone

Adani Green Energy (AGEL) has surpassed 20 gigawatts (GW) of operational renewable energy capacity, becoming the first renewable energy company in India to achieve the milestone predominantly through greenfield development. The company generates over 52 billion units of clean electricity annually. The output represents nearly 3 per cent of India's electricity consumption, enough to power New York City for a year, or almost entire Mumbai and New Delhi combined.

ADANIENSOLADANIENTADANIGREENADANIPOWERAGNICLEANCLEANMAXCONSUMERDPELENERGYENERGYDEVGKENERGYGREENPOWERGVPILINOXGREENIREDAKPELKPIGREENNDTVNTPCGREENSAATVIKGLSERVOTECHSWSOLARCapital GoodsChemicals
Explained - What led to Havells, Page Industries and Titan shares surge up to 4% on Wednesday
positive
CNBC TV18 - Markets 10d ago

Explained - What led to Havells, Page Industries and Titan shares surge up to 4% on Wednesday

Havells' growth will improve in the current financial year, according to Citi, led by strong growth in cables and wires, a gradual recovery in consumer businesses and the solar segment emerging as a meaningful growth driver.

CONSUMERCURRENTDCGDPWIRESHAVELLSJMFINANCILMOGSECPAGEINDSOLARINDSTITANCapital GoodsChemicals
Amber Group eyes $2 billion revenue milestone soon; invests Rs 6,750 crore in UP projects
positive
ET Markets - Industry 14d ago

Amber Group eyes $2 billion revenue milestone soon; invests Rs 6,750 crore in UP projects

Amber Group is poised to reach USD 2 billion in revenue soon, fueled by robust growth in its consumer durables, electronics, and railway/defence sectors. The company recently broke ground on a significant Rs 6,785 crore manufacturing expansion in Jewar, Uttar Pradesh. This includes a crucial PCB and semiconductor substrate unit via a joint venture, alongside an expanded air-conditioner complex, aiming for import substitution and future exports.

AMBERCONSUMERDEFENCEFELFELDVRHDFCGROWTHLGEINDIARPPINFRAConstructionConsumer Durables
Homebuyer can seek compensation for delayed delivery after taking possession: SC
positive
ET Markets - Industry 14d ago

Homebuyer can seek compensation for delayed delivery after taking possession: SC

Homebuyers can pursue compensation for delayed flat delivery even after taking possession, the Supreme Court ruled. The apex court overturned a previous order that denied a buyer's consumer status post-possession. The court emphasized that a claim for delayed possession arises before delivery and subsequent acceptance doesn't negate the right to seek adjudication. The case was sent back for a decision on merits.

APEXCONSUMERSUPREMESUPREMEINDSUPREMEINFCapital GoodsConstruction
At Sid’s Farm, the pursuit of milk begins with uncompromising standards
positive
ET Markets - Industry 15d ago

At Sid’s Farm, the pursuit of milk begins with uncompromising standards

Sid's Farm is strengthening consumer trust through rigorous daily quality checks and a parent-first approach to dairy production. The company invests over ₹15 lakh every month in antibiotic residue testing while rewarding farmers for maintaining quality standards. Its #HoldUsToIt campaign encourages consumers to question and verify its practices, promoting transparency over traditional brand promises. By aligning supply-chain integrity with food safety, Sid’s Farm aims to set a new benchmark for trust in India's dairy sector.

BMETRICSCONSUMERINTEGRITYTRUSTTVSSCSConstructionFinancial Services
India's AI infrastructure opportunity is being underestimated, says Abhay Laijawala
neutral
CNBC TV18 - Markets 16d ago

India's AI infrastructure opportunity is being underestimated, says Abhay Laijawala

Abhay Laijawala, MD & CIO-India at Lighthouse Canton, believes key concerns weighing on India—including oil prices, currency stability and the perception that India lacks an AI story—are turning into tailwinds. He argues investors are overlooking India's role in the global AI infrastructure buildout, spanning data centres, power, cooling systems and capital goods. Laijawala is positive on engineering, capital goods and textiles, while remaining cautious on consumer staples due to El Niño risks.

AKCAPITCONSUMERCPCAPGLOBALGVPILHGINFRAMBELOILRSYSTEMSSMARTENTDPOWERSYSUTLSOLARCapital GoodsConstruction
Missed the FII U-turn? 6 stocks turned multibagger after foreign investors corrected their mistake
positive
ET Markets - Stocks 16d ago

Missed the FII U-turn? 6 stocks turned multibagger after foreign investors corrected their mistake

Foreign institutional investors (FIIs) reversed their selling trend in six select Indian stocks, turning them into multibaggers. Bajaj Consumer Care led the pack with a 265% surge after FIIs significantly increased their stake. Other beneficiaries include Acutaas Chemicals, SML Mahindra, Dee Development Engineers, United Foodbrands, and RateGain Travel Technologies, all witnessing substantial gains following FII re-entry. This shift highlights smart money's strategic course correction.

ACUTAASALLETECBAJAJCONCHEMICALCONSUMERDEEDEVENGINERSINIREDAJGCHEMM&MRATEGAINSMLMAHUFBLAutomobile and Auto ComponentsCapital Goods
Next