Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:LGEINDIAConstruction
Clear all filters
India's growth riding on copper, govt should help boost capacity, industry body says
positive
ET Markets - Industry 1d ago

India's growth riding on copper, govt should help boost capacity, industry body says

India's infrastructure boom fuels copper demand growth significantly higher than GDP. Copper demand is projected to rise nine to ten percent annually. This surge is driven by infrastructure, clean energy, and consumer electronics needs. India has become a net importer of copper after a smelter closure. New capacities are emerging, but a deficit is still expected.

CLEANCLEANMAXCONSUMERENERGYGKENERGYKPELLGEINDIAChemicalsConstruction
Raymond shares rise 4% after former BEL chief joins defence business
positive
ET Markets - Stocks 5d ago

Raymond shares rise 4% after former BEL chief joins defence business

Raymond shares rose nearly 4% after the company appointed former Bharat Electronics Chairman and Managing Director Bhanu Prakash Srivastava as CEO of its defence business. The company expects his nearly four decades of experience in defence technologies and programme execution to strengthen its expansion into defence electronics, systems integration, aerospace and related engineering businesses.

BELDEFENCEHGINFRALGEINDIAMBELPRAKASHRAYMONDRSYSTEMSCapital GoodsConstruction
Amber Group eyes $2 billion revenue milestone soon; invests Rs 6,750 crore in UP projects
positive
ET Markets - Industry 14d ago

Amber Group eyes $2 billion revenue milestone soon; invests Rs 6,750 crore in UP projects

Amber Group is poised to reach USD 2 billion in revenue soon, fueled by robust growth in its consumer durables, electronics, and railway/defence sectors. The company recently broke ground on a significant Rs 6,785 crore manufacturing expansion in Jewar, Uttar Pradesh. This includes a crucial PCB and semiconductor substrate unit via a joint venture, alongside an expanded air-conditioner complex, aiming for import substitution and future exports.

AMBERCONSUMERDEFENCEFELFELDVRHDFCGROWTHLGEINDIARPPINFRAConstructionConsumer Durables
IKIGAI's Pankaj Tibrewal says opportunities now lie beyond the Nifty
positive
CNBC TV18 - Markets 23d ago

IKIGAI's Pankaj Tibrewal says opportunities now lie beyond the Nifty

IKIGAI Asset Manager's Pankaj Tibrewal sees a weaker rupee boosting India's export competitiveness, creating opportunities across auto parts, engineering, chemicals, textiles and electronics manufacturing.

ALPHAETFAUTOBEESAUTOIETFBANKETFBANKPSUBFSICHEMICALCONSUMERDIVOPPBEESENERGYESGEVINDIAGROWWCHEMGSEC10YEARHEALTHCAREHGINFRAINFRAINTERNETITETFJGCHEMLGEINDIALIQUIDLIQUIDPLUSLOWVOLMAKEINDIAMANUFGBEESMBELMETALMIDCAPETFMIDSMALLMOMGFMULTICAPNEXT50NIFTYETFSMALL250SMALLCAPTOP20VALUEChemicalsConstruction
Jefferies favours defence, power equipment plays; L&T, HAL among top bets
positive
Business Standard - Markets 32d ago

Jefferies favours defence, power equipment plays; L&T, HAL among top bets

Jefferies' top picks include Siemens Energy (SE), Hitachi Energy (Hitachi), Hindustan Aeronautics (HAL), Bharat Electronics (BEL), KEI Industries, and Larsen & Toubro (L&T)

BELDEFENCEDPELENERGYENRINGKENERGYGVPILHALKEIKPELLGEINDIALTPOWERINDIASIEMENSSUPREMEPWRCapital GoodsConstruction
Tamil Nadu signs Rs 18,600 crore MoU with Larsen & Toubro for data centre, shipbuilding projects
positive
ET Markets - Industry 37d ago

Tamil Nadu signs Rs 18,600 crore MoU with Larsen & Toubro for data centre, shipbuilding projects

Tamil Nadu Chief Minister V Joseph Vijay witnessed a significant MoU signing. Larsen & Toubro Limited will invest Rs 18,600 crore in three major projects. These projects will boost data centres, electronics manufacturing, and shipbuilding. Around 8,200 jobs will be created. This marks a key step towards Tamil Nadu's economic growth and industrial development.

LGEINDIALTRPPINFRATNPLConstructionConsumer Durables
How China's electronics giant Huawei plans to take on its rivals with a chip design breakthrough
positive
ET Markets - Industry 43d ago

How China's electronics giant Huawei plans to take on its rivals with a chip design breakthrough

China's electronics giant Huawei is pioneering a new chip design approach. This method focuses on reducing signal transmission time instead of shrinking transistors. The company aims to boost performance and energy efficiency. This innovation could help Huawei bypass US sanctions. High-end chips are expected by 2031. This marks a significant shift in chip development.

ENERGYENERGYDEVGKENERGYIREDAKPELLGEINDIATAKEConstructionConsumer Durables
L&T's industrial electronics arm partners EVR Motors to manufacture EV traction motors in India
neutral
CNBC TV18 - Markets 45d ago

L&T's industrial electronics arm partners EVR Motors to manufacture EV traction motors in India

The partnership combines LTEPS’ engineering, systems integration and manufacturing capabilities with EVR Motors’ traction motor technology. The traction motors are proposed to be manufactured at LTEPS’ facility in Coimbatore, Tamil Nadu.

HGINFRALGEINDIAMBELRSYSTEMSTNPLConstructionConsumer Durables
Q4 Results Today: Colgate Pamolive, Eicher Motors, Hindalco, Sun Pharma, NTPC Green, Ircon And More — Check Estimates
neutral
NDTV Profit 51d ago

Q4 Results Today: Colgate Pamolive, Eicher Motors, Hindalco, Sun Pharma, NTPC Green, Ircon And More — Check Estimates

The list of companies scheduled to report Q4 results on May 22 also includes 20 Microns, 3M India, Century Plyboards (India), DAM Capital Advisors, Electronics Mart India and more.

20MICRONSAKCAPITCENTURYPLYCPCAPDAMCAPITALEICHERMOTEMILHINDALCOIRCONLGEINDIANTPCNTPCGREENONECAP-REONELIFECAPSGMARTSPARCAutomobile and Auto ComponentsConstruction
Q4 Results LIVE Updates: Sanghvi Movers shares surge over 12%; Jubilant Foodworks down 7%
positive
CNBC TV18 - Markets 51d ago

Q4 Results LIVE Updates: Sanghvi Movers shares surge over 12%; Jubilant Foodworks down 7%

Q4 Results LIVE Updates: ITC, Aurobindo Pharma, LIC, LG Electronics, Ashoka Buildcon, Bikaji Foods, Datamatics, Engineers India, GMM Pfaudler, Happy Forgings, Honasa Consumer, Ixigo, Nykaa, Page Industries, Ramco Cements, Max Healthcare, Prestige Estates, MTNL, Sun TV, Quick Heal, RCF, WeWork, VA Tech Wabag, are among the companies reporting their earnings today. The street will also react to numbers reported by Whirlpool, Apollo Hospitals, Sammaan Capital, JK Lakshmi Cement, Lenskart, Ola Electric and others. Watch this space for all the LIVE earnings updates.

AKCAPITALLETECAPOLLOAPOLLOHOSPASHOKAAUROPHARMABIKAJICONSUMERCPCAPDATAMATICSENGINERSINGMMPFAUDLRHAPPYFORGEHCGHCG-REHEALTHCAREHEALTHYHONASAINDIACEMITCIXIGOJKCEMENTJKLAKSHMIJUBLCPLJUBLFOODLENSKARTLGEINDIALTFOODSMAXESTATESMAXHEALTHMAXINDMMFLMTNLNYKAAOLAELECPAGEINDPRESTIGEQUICKHEALRAMCOCEMRAMCOINDRCFSAMMAANCAPSANGHVIMOVSANOFICONRSPARCTECHWABAGWEWORKWHIRLPOOLZTECHAutomobile and Auto ComponentsCapital Goods
BEL Q4 Results: Profit rises 5% to Rs 2,226 crore; co declares Rs 0.55 dividend
positive
ET Markets - Stocks 53d ago

BEL Q4 Results: Profit rises 5% to Rs 2,226 crore; co declares Rs 0.55 dividend

Bharat Electronics (BEL) Q4 FY26 net profit rose 5% to Rs 2,226 crore on 11% higher revenue of Rs 10,224 crore, supported by defense projects. Full-year net profit was Rs 6,062 crore (up 14%), and revenue hit Rs 27,610 crore (up 16%). BEL also declared a Rs 0.55 final dividend.

BELDIVIDENDLGEINDIARPPINFRACapital GoodsConstruction
Kaynes Technology misses Street estimates, FY26 guidance
negative
LiveMint - Companies 58d ago

Kaynes Technology misses Street estimates, FY26 guidance

Kaynes's management blames two major projects for the electronics manufacturer's underperformance.

KAYNESLGEINDIARPPINFRACapital GoodsConstruction
2
Next