Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:FELDVRConsumer Durables
Clear all filters
Kalyan Jewellers stock to double from here? Why analysts are bullish
positive
ET Markets - Stocks 1d ago

Kalyan Jewellers stock to double from here? Why analysts are bullish

Kalyan Jewellers reported strong first-quarter revenue growth despite market headwinds. The company's international business and digital platform also showed significant expansion. Analysts are bullish, with some predicting the stock could double in value. Technical indicators suggest a positive medium-term outlook for the stock. Investors will monitor future showroom launches and festive season demand.

FELFELDVRFMNLKALYANKJILVALUEConsumer DurablesConsumer Services
Tata Motors charts $100 billion automotive ambition, commits Rs 40,000 crore to India business
positive
ET Markets - Industry 3d ago

Tata Motors charts $100 billion automotive ambition, commits Rs 40,000 crore to India business

Tata Motors aims for a USD 100 billion automotive business by FY31. The company plans substantial capital expenditure for domestic operations and JLR. Passenger vehicles will focus on aspirational products and market share growth. Jaguar Land Rover will contribute significantly to the projected sales figures. Digital technologies and AI are key investments for future operations.

3PLANDAKCAPITCPCAPFELFELDVRFMNLFOCUSMOCAPITALTATACAPTATACONSUMTATATECHTMCVTMPVTNIDETFAutomobile and Auto ComponentsCapital Goods
Dixon Tech, Coforge, 8 other stocks among Motilal’s non-Nifty ideas ahead of Q1 results
positive
ET Markets - Stocks 4d ago

Dixon Tech, Coforge, 8 other stocks among Motilal’s non-Nifty ideas ahead of Q1 results

Motilal Oswal has identified ten non-Nifty stocks for investors ahead of quarterly earnings. The brokerage anticipates healthy revenue growth across various market capitalizations. TVS Motor and Dixon Technologies are among the top picks with significant upside potential. Radico Khaitan and Indian Hotels Company also show promising revenue growth prospects. Coforge and Kirloskar Oil Engines are also highlighted for their future performance.

AONELIQUIDAONETMMQ50AONETOTALCOFORGEDIXONFELFELDVRFMNLHDFCGROWTHHDFCLIQUIDHEALTHYINDHOTELIOCKHAITANLTDKIRLOSENGKIRLOSINDLIQGRWBEESLIQUIDBETFLIQUIDPLUSMOALPHA50MOBANK10MOCAPITALMODEFENCEMOENERGYMOGOLDMOGSECMOHEALTHMOINFRAMOIPOMOLOWVOLMOM100MOM50MOMENTUM50MOMGFMOMIDMTMMOMNCMOMOMENTUMMON100MON50EQUALMONEXT50MONIFTY100MONIFTY500MONQ50MOPSEMOQUALITYMOREALTYMOSERVICEMOSILVERMOSMALL250MOTILALOFSMOTOURMOVALUEOILOILIETFRADICOSBILIQETFSDL26BEESTECHTOP10ADDTOP15IETFTOP20TVSHLTDTVSMOTORZTECHAutomobile and Auto ComponentsCapital Goods
Mahindra bets on execution as global uncertainty becomes 'structural'
positive
ET Markets - Industry 4d ago

Mahindra bets on execution as global uncertainty becomes 'structural'

Mahindra Group views global uncertainty as a permanent business feature. The conglomerate will focus on faster execution and calibrated investments. This strategy aims to capitalize on volatility rather than waiting for stability. The group reported its strongest financial performance in FY26. Future investments will target new technologies and manufacturing expansion.

FELFELDVRFOCUSGLOBALJMFINANCILM&MM&MFINAutomobile and Auto ComponentsConsumer Durables
Not sensors or AI, why revolving tyres may become the next big thing in vehicle safety
neutral
ET Markets - Industry 7d ago

Not sensors or AI, why revolving tyres may become the next big thing in vehicle safety

Future car safety is shifting from reacting to problems to predicting them, with a new focus on understanding tyre grip and road conditions in real-time. Instead of adding more hardware, software could analyze existing vehicle data to estimate traction limits before a car loses control. This innovation promises safer driving, especially in challenging conditions, without increasing manufacturing costs.

FELFELDVRFOCUSJKTYRERSSOFTWAREZFCVINDIAAutomobile and Auto ComponentsConsumer Durables
Outgoing Army Chief Says Future Wars Will Be Joint, Integrated And Theatre-Oriented
positive
NDTV Profit 10d ago

Outgoing Army Chief Says Future Wars Will Be Joint, Integrated And Theatre-Oriented

Chief of the Army Staff General Upendra Dwivedi accorded a Guard of Honour during his ceremonial farewell, in New Delhi.

FELFELDVRNDTVVGUARDConsumer DurablesConsumer Services
Nasdaq jumps over 1% as investors return to tech stocks
positive
CNBC TV18 - Markets 11d ago

Nasdaq jumps over 1% as investors return to tech stocks

The Nasdaq led gains at the open as investors returned to technology stocks amid easing geopolitical tensions. Focus now shifts to the June nonfarm payrolls report, a key gauge for future Fed policy.

FELFELDVRFOCUSTECHZTECHConsumer DurablesConsumer Services
TVS Motor looking ahead with 'measured optimism': CMD Sudarshan Venu
positive
ET Markets - Industry 12d ago

TVS Motor looking ahead with 'measured optimism': CMD Sudarshan Venu

TVS Motor Company anticipates a complex yet exciting future, aiming to meet market expectations in India despite potential weather disruptions. The company achieved a record year in FY25-26, selling 5.89 million units and becoming the world's third-largest two-wheeler maker. With a strong focus on R&D and generative AI, TVS is investing heavily in electrification and connected technologies, solidifying its leadership in the growing electric two-wheeler segment.

FELFELDVRFMNLFOCUSTVSHLTDTVSMOTORAutomobile and Auto ComponentsConsumer Durables
Astral shares in focus on demerger news but JPMorgan downgrades; check price targets
positive
CNBC TV18 - Markets 12d ago

Astral shares in focus on demerger news but JPMorgan downgrades; check price targets

Another brokerage firm CLSA said the demerger is unlikely to have a meaningful impact on the stock in the near term, adding that sustained growth and margin improvement in the chemicals business will be the key drivers for any future rerating.

ASTRALFELFELDVRFOCUSJGCHEMCapital GoodsChemicals
Big Four rethink partnership as AI changes the game
positive
ET Markets - Industry 12d ago

Big Four rethink partnership as AI changes the game

India's Big Four accounting firms, Deloitte, PwC, and EY, have surpassed 1,000 partners each, driven by rapid expansion, especially in technology consulting. This growth strains the traditional partnership model, demanding leaders adept at managing diverse businesses, embracing AI, and navigating constant reinvention. The shift necessitates a focus on innovation and adaptability to secure future success.

FELFELDVRFOCUSConsumer DurablesConsumer Services
Amber Group eyes $2 billion revenue milestone soon; invests Rs 6,750 crore in UP projects
positive
ET Markets - Industry 14d ago

Amber Group eyes $2 billion revenue milestone soon; invests Rs 6,750 crore in UP projects

Amber Group is poised to reach USD 2 billion in revenue soon, fueled by robust growth in its consumer durables, electronics, and railway/defence sectors. The company recently broke ground on a significant Rs 6,785 crore manufacturing expansion in Jewar, Uttar Pradesh. This includes a crucial PCB and semiconductor substrate unit via a joint venture, alongside an expanded air-conditioner complex, aiming for import substitution and future exports.

AMBERCONSUMERDEFENCEFELFELDVRHDFCGROWTHLGEINDIARPPINFRAConstructionConsumer Durables
ONGC rebrands itself as ‘gas and oil’ firm as natural gas output overtakes crude
positive
ET Markets - Industry 20d ago

ONGC rebrands itself as ‘gas and oil’ firm as natural gas output overtakes crude

State-run ONGC is shifting its focus, now prioritizing natural gas over crude oil. Chairman Arun Kumar Singh announced that gas production has surpassed oil, with future growth expected to be driven by expanding gas output. Policy reforms and rising domestic demand are supporting this strategic pivot, as ONGC invests heavily in offshore projects and explores clean energy avenues.

CLEANCLEANMAXENERGYFELFELDVRFOCUSGKENERGYKPELOILOILIETFONGCRPPINFRAVOGLChemicalsConstruction
Next