Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:MEDANTAConsumer Services
Clear all filters
Kill Infinite Scroll: EU Demands Meta Dismantle 'Addictive' Features On Facebook And Instagram
negative
NDTV Profit 1d ago

Kill Infinite Scroll: EU Demands Meta Dismantle 'Addictive' Features On Facebook And Instagram

The commission said Meta had failed to properly assess the risks its design features pose to the physical and mental health of users.

ADDICTIVEMEDANTAConsumer ServicesHealthcare
Policybazaar ropes in Amitabh Bachchan for insurance awareness movement
positive
ET Markets - Industry 1d ago

Policybazaar ropes in Amitabh Bachchan for insurance awareness movement

Policybazaar has appointed veteran actor Amitabh Bachchan as its brand ambassador. This move initiates a significant movement for health and term insurance awareness nationwide. The initiative aligns with IRDAI's vision of providing insurance for all Indians by 2047. Bachchan's established image of trust will encourage families to prioritize financial protection. This campaign aims to secure the future of over 140 crore Indians.

ALLETECFELFELDVRJMFINANCILMEDANTANIVABUPASTARHEALTHTRUSTTVVISIONConsumer ServicesFinancial Services
Top fashion brands have a supply chain battle against extreme India heat
positive
ET Markets - Industry 2d ago

Top fashion brands have a supply chain battle against extreme India heat

As Indian garment factories contend with soaring temperatures, worker efficiency and health have been jeopardised. Epic Group's facility in Odisha has introduced cutting-edge cooling technology to combat these challenges. Employees have reported substantial improvements in concentration and comfort in the climate-managed setting.

BMETRICSGOCOLORSMEDANTATVSSCSConsumer ServicesHealthcare
NEWS
positive
Business Standard - Markets 4d ago

Economic and trade cooperation remains a key pillar of India-Indonesia ties

India and Indonesia issued a joint statement on the State Visit by Prime Minister of India to Indonesia. Prime Minister Modi and President Prabowo held official bilateral talks on 7 July 2026 at Istana Merdeka, Jakarta. The official talks covered the full spectrum of bilateral relations, including political engagement, defence and security cooperation, maritime cooperation, trade and investment, digital economy, science and technology, space, critical minerals, energy, agriculture, health, pharma, education, culture, tourism, youth exchanges and people-to-people ties, in addition to regional and global developments of mutual interest. They also witnessed the exchange of a number of bilateral documents, aimed at further strengthening the India-Indonesia Comprehensive Strategic Partnership.

AXISBPSETFBFINVESTDEFENCEENERGYGKENERGYGLOBALGOLD1GOLDBETAGROWWDEFNCHDFCGOLDIEXKPELLICNETFSENMEDANTAMIDCAPBETAMODEFENCEMOENERGYMOTOURNEXT50BETAPARASPHARMABEESSARDAENSILVERBETASPECTRUMSTARTATAGOLDTATSILVTNIDETFCapital GoodsConstruction
Cracks in cola kingdom: India's duopoly faces biggest test in decades
neutral
ET Markets - Industry 9d ago

Cracks in cola kingdom: India's duopoly faces biggest test in decades

India's cola market is undergoing a significant transformation, moving beyond the traditional Coca-Cola vs. PepsiCo rivalry. Reliance's Campa revival ignited a price war, while ITC's new premium, sugar-free coconut cola signals a shift towards health, premiumization, and niche offerings. This evolving landscape caters to health-conscious consumers seeking alternatives, indicating a more dynamic and diversified future for the Indian beverage sector.

DYNAMICFELFELDVRFMNLITCMEDANTAPREMIUMRELIANCERELINFRAAutomobile and Auto ComponentsConsumer Services
ITC enters cola business to add more fizz to beverages portfolio
positive
ET Markets - Industry 9d ago

ITC enters cola business to add more fizz to beverages portfolio

India's carbonated soft drinks market is intensifying as ITC launches a premium sugar-free Coconut Cola, aiming to compete with global giants Coca-Cola and PepsiCo. This move follows Reliance Industries' aggressive pricing strategy with its revived Campa brand. ITC plans to expand its beverage offerings, focusing on the premium, health-conscious segment, which is experiencing rapid growth due to increasing consumer preference for low- and no-sugar options.

CONSUMERGLOBALITCMEDANTAPREMIUMRELIANCERELINFRAAutomobile and Auto ComponentsConsumer Services
mRNA vaccines protect against severe infectious diseases, review confirms
positive
ET Markets - Industry 10d ago

mRNA vaccines protect against severe infectious diseases, review confirms

Billions of mRNA vaccine doses administered globally confirm their safety and effectiveness against infectious diseases, including severe COVID-19, across all age groups and health conditions. Researchers emphasize that serious side effects are rare, with benefits far outweighing risks. This technology, now proven, holds immense promise for future vaccines and personalized treatments, though equitable global access remains crucial.

ALLETECFELFELDVRGLOBALMEDANTAConsumer ServicesHealthcare
Motilal Oswal sector of the week: Healthcare; Max, Global Health top picks
positive
Business Standard - Markets 11d ago

Motilal Oswal sector of the week: Healthcare; Max, Global Health top picks

Indian healthcare sector remains well positioned for sustained long-term growth, supported by structural demand, expanding hospital infra, higher healthcare spends, and favourable demographic trends.

GLOBALHCGHCG-REHEALTHCAREINFRALTGILTBEESMAXHEALTHMAXINDMEDANTAMOALPHA50MOBANK10MOCAPITALMODEFENCEMOENERGYMOGOLDMOGSECMOHEALTHMOINFRAMOIPOMOLOWVOLMOM100MOM50MOMENTUM50MOMGFMOMIDMTMMOMNCMOMOMENTUMMON100MON50EQUALMONEXT50MONIFTY100MONIFTY500MONQ50MOPSEMOQUALITYMOREALTYMOSERVICEMOSILVERMOSMALL250MOTILALOFSMOTOURMOVALUEConsumer ServicesFinancial Services
WHO seeks details from India over oxytocin-linked deaths; licences of manufacturer cancelled
negative
ET Markets - Industry 15d ago

WHO seeks details from India over oxytocin-linked deaths; licences of manufacturer cancelled

The World Health Organisation (WHO) has sought details from the Indian government after reports linked oxytocin injections made by Jackson Laboratories to maternal deaths in Rajasthan. The Centre said this is part of a routine global pharmacovigilance process and not a finding against the product or manufacturer.

GLOBALMEDANTAConsumer ServicesHealthcare
HDFC Mutual Fund buys additional 10 lakh shares of Global Health for Rs 130 crore
positive
ET Markets - Stocks 16d ago

HDFC Mutual Fund buys additional 10 lakh shares of Global Health for Rs 130 crore

HDFC Mutual Fund has secured an additional 10 lakh shares of Global Health, which is known for operating Medanta hospitals, from co-founder Sunil Sachdeva for Rs 130 crore. This acquisition builds on a prior purchase made last month. The transaction accounts for a 0.37% stake in the company. In related news, Global Health has reported an impressive 39.7% increase in its fourth-quarter profit after tax, totaling Rs 141.7 crore.

ABSLPSEALPHAALPHAETFAONEGOLDAONELIQUIDAONENIFTYAONESILVERAONETOTALAUTOBEESAUTOIETFAXISBPSETFBANK10ADDBANKADDBANKBETFBANKETFBANKPSUBBETF0432BBNPNBETFBBNPPGOLDBFSIBNKETFAXISCHEMICALCHOICEGOLDCOMMOIETFCONSUMAXISDEFENCEDIVIDENDEBANKNIFTYEBBETF0430EBBETF0431EBBETF0433ECAPINSUREEGOLDELIQUIDELM250ENERGYENIFTYEQUAL200EQUAL50EQUAL50ADDESENSEXESGESILVERFINIETFFLEXIADDFMCGADDFMCGIETFGILT10BETAGILT5BETAGLOBALGOLD1GOLD360GOLDADDGOLDAXISGOLDBETAGOLDBNDGOLDETFGROWWCAPMGROWWCHEMGROWWDEFNCGROWWEVGROWWGOLDGROWWHOSPIGROWWLIQIDGROWWLOVOLGROWWMC150GROWWMETALGROWWMOM50GROWWN200GROWWNETGROWWNIFTYGROWWNXT50GROWWPOWERGROWWPSEGROWWPSUBKGROWWRAILGROWWRLTYGROWWSC250GROWWSLVRGSEC10IETFGSEC10YEARHDFCGOLDHDFCGROWTHHDFCLOWVOLHDFCMID150HDFCMOMENTHDFCNEXT50HDFCNIF100HDFCNIFITHDFCPSUBKHDFCPVTBANHDFCQUALHDFCSILVERHDFCSML250HDFCVALUEHEALTHADDHEALTHAXISHEALTHCAREHEALTHIETFHSBCGOLDICICIB22INFRAIETFINTERNETITADDITAXISITBEESITBETAITETFITIETFLICNETFSENLICNMID100LIQGRWBEESLIQUIDLIQUID1LIQUIDPLUSLIQUIDSBILIQUIDSHRILOWVOLMAFANGMAHKTECHMAKEINDIAMANUFGBEESMASPTOP50MEDANTAMETALMETALIETFMID150MIDCAPADDMIDCAPBETAMIDCAPETFMIDCAPIETFMIDQ50ADDMNCMOALPHA50MOBANK10MOCAPITALMODEFENCEMOENERGYMOGOLDMOGSECMOHEALTHMOINFRAMOIPOMOLOWVOLMOM100MOM30IETFMOM50MOMENTUMMOMENTUM30MOMENTUM50MOMGFMOMIDMTMMOMNCMOMOMENTUMMON100MON50EQUALMONEXT50MONIFTY100MONIFTY500MONQ50MOPSEMOQUALITYMOREALTYMOSERVICEMOSILVERMOSMALL250MOTOURMOVALUEMSCIADDMSCIINDIAMULTICAPNEXT30ADDNEXT50NEXT50ADDNEXT50BETANEXT50ETFNEXT50IETFNIFTY100EWNIFTYADDNIFTYAXISNIFTYBETFNIFTYETFNIFTYQLITYOILIETFPHARMABEESPSUBANKADDPSUBNKIETFPVTBANKADDQUALITY30SBIBPBSBIETFCONSBIETFITSBIETFPBSBIETFQLTYSBILIQETFSBINEQWETFSBINMID150SBISILVERSELECTIPOSENSEXAXISSENSEXETFSETF10GILTSILVERSILVER1SILVER360SILVERADDSILVERAGSILVERAXISSILVERBEESSILVERBETASILVERBNDSILVERIETFSMALL250SMALLADDSNXT30BEESTATAGOLDTATSILVTECHTNIDETFTOP10ADDTOP20TWCGOLDETFUNIONGOLDVAL30IETFVALUEVALUEAXISConsumer ServicesFinancial Services
NEWS
positive
Business Standard - Markets 16d ago

Volumes jump at Global Health Ltd counter

Global Health Ltd saw volume of 10.02 lakh shares by 10:46 IST on BSE, a 60.42 fold spurt over two-week average daily volume of 16586 shares

BSEGLOBALMEDANTAConsumer ServicesFinancial Services
NEWS
positive
Business Standard - Markets 17d ago

Shilpa Biologicals commissions Antibody-Drug Conjugate (ADC) GMP manufacturing facility

Shilpa Biologicals, a material subsidiary of Shilpa Medicare, announced the commissioning of a state-of-the-art Antibody-Drug Conjugate (ADC) GMP manufacturing facility, purpose-built and designed to meet global regulatory approval standards including US FDA, EMA, and other major health authority requirements. The facility is fully operational, with GMP qualification protocols now actively underway, placing Shilpa on a clear path to commercial readiness.

GLOBALMEDANTASHILPAMEDConsumer ServicesHealthcare
Next