Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:PREMIERConsumer Services
Clear all filters
NEWS
negative
Business Standard - Markets 1d ago

Schneider Electric Infrastructure Ltd leads losers in 'A' group

Swiggy Ltd, Premier Explosives Ltd, Kaynes Technology India Ltd and Ethos Ltd are among the other losers in the BSE's 'A' group today, 10 July 2026.

BSEETHOSLTDKAYNESPREMEXPLNPREMIERSCHNEIDERSWIGGYCapital GoodsChemicals
Market Pulse: Key triggers to watch before the July 10 trading session
negative
CNBC TV18 - Markets 2d ago

Market Pulse: Key triggers to watch before the July 10 trading session

Friday is expected to be an eventful session for Indian markets, with investors set to react to TCS' June quarter earnings. Market participants will also track the impact of Apollo Micro Systems' ₹1,550-crore acquisition of a 41.33% stake in Premier Explosives.On the global front, US markets traded higher, supported by gains in semiconductor stocks and lower oil prices, although renewed tensions between Washington and Tehran kept investors cautious. Traders will also monitor the impact of lower-than-expected US jobless claims and June existing home sales data on sentiment.

APOLLOGLOBALIOCOILPREMEXPLNPREMIERRSYSTEMSTCSCapital GoodsChemicals
Sonu Nigam, Scout join GEPL as franchise owners ahead of Season 3
positive
ET Markets - Industry 4d ago

Sonu Nigam, Scout join GEPL as franchise owners ahead of Season 3

Playback singer Sonu Nigam and gaming creator Scout are new franchise owners. They join the Global e-Cricket Premier League's third season expansion. The tournament will feature eight teams and a significant prize pool. This move reflects esports' growing mainstream acceptance and diverse appeal. The league aims to nurture Indian esports athletes and build global relevance.

GLOBALPREMIERSINGERINDCapital GoodsConsumer Durables
NEWS
negative
Business Standard - Markets 4d ago

Trent Ltd leads losers in 'A' group

Premier Explosives Ltd, Kalyan Jewellers India Ltd, Avalon Technologies Ltd and Himadri Speciality Chemical Ltd are among the other losers in the BSE's 'A' group today, 07 July 2026.

AVALONBSECHEMICALHSCLKALYANKJILPARAGONPREMEXPLNPREMIERSPECIALITYTRENTCapital GoodsChemicals
Street Signals: Technical charts point to further upside for Nifty
positive
ET Markets - Stocks 19d ago

Street Signals: Technical charts point to further upside for Nifty

Indian stock markets are showing a positive outlook, with analysts predicting the Nifty could climb towards 24,300-24,600. Key support levels are identified around 23,700-23,900, encouraging investors to buy on dips. Several stocks, including Britannia Industries, Grasim Industries, Aditya Birla Capital, Premier Energies, Bharat Electronics, and Eternal, are highlighted as top picks for the week, with specific buy recommendations and targets.

ABCAPITALABFRLABGSECABLBLABRELABSL10BANKABSLAMCABSLBANETFABSLLIQUIDABSLNN50ETABSLPSEAKCAPITARIHANTCAPBELBIRLACORPNBIRLAMONEYBRITANNIABSLGOLDETFBSLNIFTYBSLSENETFGCPCAPECAPINSUREETERNALGRASIMGROWWCAPMGSEC10ABSLHEALTHYLGEINDIAMOCAPITALMOMENTUMNIFTYQLITYPREMIERPREMIERENESDL26BEESSILVERTECHTOP10ADDTOP15IETFTOP20Capital GoodsConstruction Materials
Cloudnine's 25% stake sale attracts top global PE firms
positive
ET Markets - Industry 25d ago

Cloudnine's 25% stake sale attracts top global PE firms

Leading global private equity firms are in the running to acquire a substantial minority stake in Cloudnine, India's premier maternity and paediatric hospital chain. The deal is expected to value the company at approximately $1.2 billion. This strategic move will see existing investor True North exit, while other shareholders are likely to retain their positions.

GLOBALPREMIERVALUECapital GoodsConsumer Services
TCS, Anthropic announce global premier partnership for Enterprise AI scaling
neutral
CNBC TV18 - Markets 30d ago

TCS, Anthropic announce global premier partnership for Enterprise AI scaling

TCS will integrate its domain-led engineering expertise—such as capabilities in claims adjudication and lending advisory, into the Claude Code ecosystem through reusable skills and plugins.

GLOBALHGINFRAMBELPREMIERTCSCapital GoodsConstruction
Nomura Asset, Capital Group, others buy 5.3% stake in Premier Energies for Rs 2,291 cr
positive
ET Markets - Industry 46d ago

Nomura Asset, Capital Group, others buy 5.3% stake in Premier Energies for Rs 2,291 cr

Global financial institutions and Indian mutual funds have bought a 5.3 percent stake in Premier Energies. The deal involved promoters selling shares worth over Rs 2,291 crore. This investment comes as Premier Energies secured significant orders for solar cells and modules. The company is expanding its manufacturing capacities for cells and modules.

AKCAPITALPHAETFBANKETFBANKPSUBFINVESTBFSICPCAPDEFENCEDIVIDENDECAPINSUREENERGYEQUAL200EQUAL50ESGGLOBALGOLDETFGROWWCAPMGSEC10YEARHEALTHCAREINTERNETITETFJMFINANCILLIQUIDLIQUIDPLUSLOWVOLMAFANGMAHKTECHMAKEINDIAMANUFGBEESMASPTOP50METALMIDCAPETFMOCAPITALMOMGFMULTICAPNAHARCAPNEXT50NIFTYETFPREMIERPREMIERENESELECTIPOSENSEXETFSILVERAGSMALL250SOLARINDSTOP20VALUECapital GoodsChemicals
Stocks to Watch today: Vodafone Idea, ONGC, Suzlon, RVNL, Premier Energies
positive
Business Standard - Markets 46d ago

Stocks to Watch today: Vodafone Idea, ONGC, Suzlon, RVNL, Premier Energies

Stocks to Watch today, May 26, 2026: Hitachi Energy, Container Corp, IRCTC, Indian Metals & Ferro Alloys are among the top stocks to watch during today's trading session

CONCORENERGYGKENERGYIDEAIEXIMFAIRCTCIREDAJAINAMKPELLLOYDSMEONGCPOWERINDIAPREMIERPREMIERENERVNLSDL26BEESSUZLONCapital GoodsConstruction
Premier Energies Q4 profit jumps 64% as solar demand lifts revenue; plans ₹5,000 crore fundraising
positive
CNBC TV18 - Markets 57d ago

Premier Energies Q4 profit jumps 64% as solar demand lifts revenue; plans ₹5,000 crore fundraising

Strong revenue growth boosted Premier Energies’ quarterly profit, while the company also unveiled plans to raise ₹5,000 crore for future expansion.

FELFELDVRPREMIERPREMIERENESOLARINDSCapital GoodsChemicals
Q4 Results LIVE Updates: JSW Steel, Muthoot react to results; Tata Steel, Power Grid report today
positive
CNBC TV18 - Markets 57d ago

Q4 Results LIVE Updates: JSW Steel, Muthoot react to results; Tata Steel, Power Grid report today

Q4 Results LIVE Updates: Two Nifty 50 companies Tata Steel and Power Grid along with broader market names like ITC Hotels, Hindustan Copper, Godfrey Phillips, Gland Pharma, Cochin Shipyard, Deepak Nitrite, Balrampur Chini, Arvind, Bajaj Electricals, Aarti Drugs, Aether Industries, Alembic Pharma, NCC, NHPC, Premier Energies, SAIL, SJVN, Solara Active Pharma, Symphony, Thangamayil, Triveni Engineering, VST Tillers, are among the companies reporting their earnings today. JSW Steel, Muthoot Finance, Apollo Tyres, Endurance Tech, Voltas, are some of the other result reactions today. Watch this space for all the LIVE updates.

AARTIDRUGSAARTIINDABHAPOWERAETHERALEMBICLTDALLETECAONETMMQ50AONETOTALAPOLLOAPOLLOTYREAPOLSINHOTARVINDBAJAJELECBAJAJHFLBAJAJSTBAJFINANCEBALRAMCHINBANKBETFCOCHINSHIPDEEPAKNTRENDURANCEGLANDGODFRYPHLPGVPILHGINFRAHINDCOPPERITCITCHOTELSJSWHLJSWINFRAJSWSTEELLIQUIDBETFLTFMBELMOCAPITALMSPLMUTHOOTFINNCCNETFNHPCNIFTYBETFNPBETPARTHPFCPHARMABEESPOWERGRIDPREMIERPREMIERENESAILSALSTEELSJVNSOLARASYMPHONYTATAPOWERTATASTEELTATATECHTECHTNIDETFTRIVENIVIVIANAVOLTASVSTINDZTECHAutomobile and Auto ComponentsCapital Goods
Q4 Results Today: Cochin Shipyard, Godfrey Phillips, ITC Hotels, Premier Energies, NCC, SJVN, Tata Steel And More
positive
NDTV Profit 57d ago

Q4 Results Today: Cochin Shipyard, Godfrey Phillips, ITC Hotels, Premier Energies, NCC, SJVN, Tata Steel And More

Power Grid Corporation of India, NHPC, SAIL and Devyani International are among the companies that will declare earnings on May 15.

ABHAPOWERCOCHINSHIPDEVYANIGODFRYPHLPGVPILITCITCHOTELSMSPLNCCNHPCPOWERGRIDPREMIERPREMIERENESAILSALSTEELSJVNTATAPOWERTATASTEELTATATECHCapital GoodsConstruction
2
Next