Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:PREMIUMFast Moving Consumer Goods
Clear all filters
Marico targets Rs 15,000 crore revenue in FY27, eyes Rs 20,000 crore by FY30 on premiumisation push
neutral
ET Markets - Industry 2d ago

Marico targets Rs 15,000 crore revenue in FY27, eyes Rs 20,000 crore by FY30 on premiumisation push

Marico aims for Rs 15,000 crore revenue by FY27 and Rs 20,000 crore by FY30. The company is focusing on premium products and expanding its digital-first brands. Its total addressable market is expected to triple by FY30. Marico's digital-first portfolio already generates over Rs 1,100 crore annually. The foods business crossed Rs 1,000 crore revenue in FY26.

AONETMMQ50AONETOTALLTFOODSMARICOPREMIUMTOTALWEALTHAutomobile and Auto ComponentsFast Moving Consumer Goods
India's growth story 'remains intact', bets on rising consumer aspirations for future growth: Dabur
positive
ET Markets - Industry 5d ago

India's growth story 'remains intact', bets on rising consumer aspirations for future growth: Dabur

Dabur India sees its growth story remaining intact despite global uncertainties. Rising consumer aspirations and strong domestic demand fuel the company's future expansion plans. The FMCG major reported a five percent revenue growth and profit increase for the fiscal. Dabur is investing in new facilities and premium offerings to attract younger consumers.

CONSUMERDABURFELFELDVRGLOBALPREMIUMAutomobile and Auto ComponentsConsumer Services
Radico Khaitan eyes 20 pc volume growth in premium portfolio in FY27
positive
ET Markets - Industry 6d ago

Radico Khaitan eyes 20 pc volume growth in premium portfolio in FY27

Radico Khaitan anticipates a robust 20% growth in its premium spirits segment this fiscal year, alongside a 120 basis point margin expansion. The company is capitalising on the rising popularity of white spirits, particularly vodka, and aims to expand its luxury portfolio. With strong sales in FY26, Radico Khaitan is strategically focusing on innovation and global market penetration for its Indian brands.

GLOBALKHAITANLTDMOGSECPREMIUMRADICOAutomobile and Auto ComponentsConsumer Durables
Mother Sparsh sees up to 40% growth as baby-care boom defies consumer slowdown
positive
ET Markets - Industry 8d ago

Mother Sparsh sees up to 40% growth as baby-care boom defies consumer slowdown

Mother Sparsh anticipates a robust 30-40% revenue surge this year, defying broader consumption slowdowns. Indian parents are prioritizing their babies' health and well-being, investing in premium, 'no nasties' products. Leveraging ITC's extensive distribution, the brand aims to expand its reach beyond online channels into smaller cities, tapping into a growing demand for trusted, scientifically-backed baby care solutions.

AGARWALEYEAMRUTANJANBAJAJCONCONSUMERGANESHCPGODREJCPITCIWPJUBLCPLLIBASMEDANTAMOGSECPGHHPREMIUMTATACONSUMZOTAAutomobile and Auto ComponentsChemicals
Quick commerce is helping Nestle India's premium products reach beyond metros, MD Tiwary says at AGM
positive
ET Markets - Industry 8d ago

Quick commerce is helping Nestle India's premium products reach beyond metros, MD Tiwary says at AGM

Nestle India is prioritizing quick commerce for premium products and focusing on healthier reformulations, according to Chairman Manish Tiwary. The company is expanding its digital reach and improving nutritional profiles by reducing sugar, salt, and fat. Rural India is identified as a key growth driver, with investments in distribution and technology to support future demand and brand building.

FELFELDVRNESTLEINDPREMIUMSHANKARAAutomobile and Auto ComponentsConsumer Services
Cracks in cola kingdom: India's duopoly faces biggest test in decades
neutral
ET Markets - Industry 9d ago

Cracks in cola kingdom: India's duopoly faces biggest test in decades

India's cola market is undergoing a significant transformation, moving beyond the traditional Coca-Cola vs. PepsiCo rivalry. Reliance's Campa revival ignited a price war, while ITC's new premium, sugar-free coconut cola signals a shift towards health, premiumization, and niche offerings. This evolving landscape caters to health-conscious consumers seeking alternatives, indicating a more dynamic and diversified future for the Indian beverage sector.

DYNAMICFELFELDVRFMNLITCMEDANTAPREMIUMRELIANCERELINFRAAutomobile and Auto ComponentsConsumer Services
ITC enters cola business to add more fizz to beverages portfolio
positive
ET Markets - Industry 9d ago

ITC enters cola business to add more fizz to beverages portfolio

India's carbonated soft drinks market is intensifying as ITC launches a premium sugar-free Coconut Cola, aiming to compete with global giants Coca-Cola and PepsiCo. This move follows Reliance Industries' aggressive pricing strategy with its revived Campa brand. ITC plans to expand its beverage offerings, focusing on the premium, health-conscious segment, which is experiencing rapid growth due to increasing consumer preference for low- and no-sugar options.

CONSUMERGLOBALITCMEDANTAPREMIUMRELIANCERELINFRAAutomobile and Auto ComponentsConsumer Services
ITC's packaged foods business crosses $2 billion in revenue
positive
ET Markets - Industry 15d ago

ITC's packaged foods business crosses $2 billion in revenue

ITC's packaged food business soared past $2 billion in FY26, with overall FMCG consumer spending reaching Rs 37,000 crore. This growth was fueled by premium product launches and a favorable tax environment. While the food segment remains the largest FMCG contributor, other businesses saw modest gains. The company faces challenges from increased cigarette taxation but remains optimistic about its market position.

CONSUMERITCLTFOODSMVKAGROPREMIUMAutomobile and Auto ComponentsFast Moving Consumer Goods
Chips or chocolates, India's brands want you to pay more for a fitter you
positive
ET Markets - Industry 15d ago

Chips or chocolates, India's brands want you to pay more for a fitter you

From millet chips and protein-rich chocolates to science-backed skincare, FMCG companies are increasingly premiumising everyday products to drive growth beyond volumes. Backed by rising demand for health, nutrition and convenience, brands are leveraging trusted names to launch higher-margin variants, while industry data shows premium categories continuing to outpace the broader market despite concerns over whether healthier claims always translate into better nutrition.

MEDANTAPREMIUMSHANTHALAAutomobile and Auto ComponentsFast Moving Consumer Goods
Jyothy Labs to expand Exo into broader dishwash franchise after Henkel brands exit portfolio
positive
ET Markets - Industry 20d ago

Jyothy Labs to expand Exo into broader dishwash franchise after Henkel brands exit portfolio

Jyothy Labs is strategically expanding its Exo dishwash brand into a comprehensive franchise following Henkel's exit from Pril and Fa licensing in India. The company remains cautiously optimistic about FY27 growth, focusing on premium products, innovation, and wider distribution despite inflationary pressures. New Exo variants are showing promising consumer response, aiming to boost sales and market share.

CONSUMERGANESHCPGODREJCPJUBLCPLJYOTHYLABLIBASPREMIUMTATACONSUMAutomobile and Auto ComponentsChemicals
Dalmia Bharat plans to raise Rs 4,000 cr; targets 110-130 MTPA cement capacity by FY31
positive
ET Markets - Industry 20d ago

Dalmia Bharat plans to raise Rs 4,000 cr; targets 110-130 MTPA cement capacity by FY31

Dalmia Bharat is set to raise up to Rs 4,000 crore to fuel its ambitious expansion, aiming to reach 110-130 million tonnes per annum cement capacity by FY31. This strategic move, involving acquisitions and organic growth, aligns with anticipated industry demand driven by infrastructure and housing. The company is also focusing on premium products and strengthening its pan-India presence, building on recent acquisitions and strong financial performance.

BBETF0432DALBHARATDALMIASUGJKCEMENTJMFINANCILMBAPLPREMIUMSHANKARAAutomobile and Auto ComponentsChemicals
Premium push shields Gillette, Whisper makers as supply chain costs rise
positive
LiveMint - Companies 25d ago

Premium push shields Gillette, Whisper makers as supply chain costs rise

High-margin offerings like sleep gummies and electric razors are helping the consumer goods majors offset severe raw material inflation triggered by the US-Iran conflict, a top executive said.

BMETRICSCONSUMERGILLETTEPREMIUMTVSSCSAutomobile and Auto ComponentsFast Moving Consumer Goods
Next