Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:MEDANTAForest Materials
Clear all filters
Mother Sparsh sees up to 40% growth as baby-care boom defies consumer slowdown
positive
ET Markets - Industry 8d ago

Mother Sparsh sees up to 40% growth as baby-care boom defies consumer slowdown

Mother Sparsh anticipates a robust 30-40% revenue surge this year, defying broader consumption slowdowns. Indian parents are prioritizing their babies' health and well-being, investing in premium, 'no nasties' products. Leveraging ITC's extensive distribution, the brand aims to expand its reach beyond online channels into smaller cities, tapping into a growing demand for trusted, scientifically-backed baby care solutions.

AGARWALEYEAMRUTANJANBAJAJCONCONSUMERGANESHCPGODREJCPITCIWPJUBLCPLLIBASMEDANTAMOGSECPGHHPREMIUMTATACONSUMZOTAAutomobile and Auto ComponentsChemicals
AB Group reaffirms bet on Voda Idea with ₹4,730 Cr infusion
positive
ET Markets - Industry 30d ago

AB Group reaffirms bet on Voda Idea with ₹4,730 Cr infusion

Vodafone Idea shareholders approved a ₹4,730-crore investment from the Aditya Birla Group via preferential allotment of warrants, increasing AB Group's stake to around 13%. Chairman Kumar Mangalam Birla stated the company's focus now shifts to execution across operations, customer service, and network expansion. This capital infusion will support capital expenditure and loan repayment, reinforcing Vi's financial health.

ABCAPITALABFRLABGSECABLBLABRELABSL10BANKABSLAMCABSLBANETFABSLLIQUIDABSLNN50ETABSLPSEAKCAPITBFINVESTBIRLACORPNBIRLAMONEYBSLGOLDETFBSLNIFTYBSLSENETFGCPCAPFOCUSGSEC10ABSLHEALTHYIDEAJMFINANCILMANGALAMMEDANTAMGELMOMENTUMNAHARCAPNIFTYQLITYSERVICESILVERTECHConstruction MaterialsConsumer Durables
From gym tubs to kitchen staples: Protein becomes India’s new food trend
positive
ET Markets - Industry 33d ago

From gym tubs to kitchen staples: Protein becomes India’s new food trend

India's food market is seeing a surge in protein-enriched products. These items are moving beyond fitness enthusiasts to everyday consumers. Companies are fortifying everything from atta to coffee. This trend reflects growing health awareness and changing lifestyles. The market is expected to expand further as protein becomes a regular part of Indian diets.

IWPMEDANTASAWALIYAFast Moving Consumer GoodsForest Materials
German firm B+H Solutions to invest 1 mn euro in India to expand nano-fertiliser business
positive
ET Markets - Industry 47d ago

German firm B+H Solutions to invest 1 mn euro in India to expand nano-fertiliser business

German agritech firm B+H Solutions GmbH plans to invest €1 million in India in 2026 to expand its footprint in the country's growing agricultural sector. The company is strengthening its presence with its range of metal-based nano-fertilisers, driven by rising demand, favourable regulatory approvals, and increasing acceptance of nanotechnology among Indian farmers. Designed to improve crop yields, nutrient efficiency, and plant health, B+H Solutions' innovative products are gaining traction as India embraces advanced farming solutions. The investment underscores the growing potential of the Indian nano-fertiliser market and the role of sustainable agricultural technologies in boosting farm productivity.

AGRITECHBFINVESTEUROBONDIWPMEDANTAMETALCapital GoodsFast Moving Consumer Goods
​Paytm, Urban Company among 10 companies with highest FII shareholding in Q4. Check full list
positive
ET Markets - Stocks 57d ago

​Paytm, Urban Company among 10 companies with highest FII shareholding in Q4. Check full list

​Foreign investors are showing interest in select Indian companies. Despite a significant outflow from Indian equities, some firms have attracted substantial FII investment. Le Travenues Technology leads with the highest FII stake. Other notable companies include 360 One WAM, Redington, CarTrade Tech, and Agarwal's Health Care.​

360ONEAGARWALEYEAMRUTANJANBFINVESTCARTRADEGOLD360IXIGOMEDANTANRAILPAYTMPGHHREDINGTONSILVER360TECHURBANURBANCOZOTAZTECHConsumer ServicesFast Moving Consumer Goods
Aditya Birla Health bets on wellness incentives to improve claims ratios
positive
LiveMint - Companies 59d ago

Aditya Birla Health bets on wellness incentives to improve claims ratios

Aditya Birla Health wants to reward healthier customers, nudge those on the edge to be more consistent, and, lastly, intervene with high-risk customers to help them manage their health.

ABCAPITALABFRLABGSECABLBLABRELABSLAMCABSLBANETFABSLLIQUIDABSLNN50ETABSLPSEBIRLACORPNBIRLAMONEYBSLGOLDETFBSLNIFTYBSLSENETFGGSEC10ABSLHEALTHYMEDANTAMOMENTUMNIFTYQLITYSILVERTECHConstruction MaterialsConsumer Services
Manipal Health acquires land, hospital in Mumbai’s Andheri for Rs 495 crore
positive
ET Markets - Industry 61d ago

Manipal Health acquires land, hospital in Mumbai’s Andheri for Rs 495 crore

Manipal Health Enterprises has made headlines by purchasing a hospital site in Andheri, Mumbai for Rs 495 crore. This acquisition is a slice of a broader Rs 908 crore deal, signaling a robust appetite for healthcare real estate among investors in major Indian cities.

3PLANDABRELHCGHCG-REHEALTHCAREMEDANTATRELFinancial ServicesForest Materials
Manipal Health buys Mumbai hospital asset for ₹495 crore in Andheri
positive
CNBC TV18 - Markets 61d ago

Manipal Health buys Mumbai hospital asset for ₹495 crore in Andheri

Manipal Health Enterprises buys Andheri hospital asset in Mumbai for ₹495 crore from Khubchandani entities, deal registered May 6 2026, highlighting demand for healthcare real estate

ABRELHCGHCG-REHEALTHCAREMEDANTATRELFinancial ServicesForest Materials
IBA calls for 10 pc fermented organic manure blending with fertilizers to save $2 bn imports
positive
ET Markets - Industry 62d ago

IBA calls for 10 pc fermented organic manure blending with fertilizers to save $2 bn imports

The Indian Biogas Association proposes a 10% mandatory blending of fermented organic manure with chemical fertilizers by 2030, aiming to save USD 2 billion annually in imports. This initiative, detailed in a white paper, seeks to restore soil health and promote sustainable agriculture through phased implementation and integration into government schemes.

CHEMICALJKPAPERMEDANTAFinancial ServicesForest Materials
EAC-PM working paper calls for curbs on tobacco consumption; says it poses serious implications for public health
positive
ET Markets - Industry 135d ago

EAC-PM working paper calls for curbs on tobacco consumption; says it poses serious implications for public health

Tobacco consumption and spending have increased sharply in both rural and urban India between 2011-12 and 2023-24, raising concerns for public health and government finances, according to an Economic Advisory Council to the Prime Minister (EAC-PM) working paper. Per capita tobacco expenditure rose 58% in rural areas and 77% in urban areas, with tobacco-using households rising to 13.3 crore in rural India and 4.7 crore in urban India.

JKPAPERMEDANTAURBANURBANCOConsumer ServicesForest Materials