Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:EVIETFHealthcare
Clear all filters
Blue Jet Healthcare shares rally 9% after Rs 800 crore QIP allotment
positive
ET Markets - Stocks 1d ago

Blue Jet Healthcare shares rally 9% after Rs 800 crore QIP allotment

Blue Jet Healthcare shares rose sharply on Friday after the company completed its Rs 800 crore QIP, attracting marquee institutional investors, including multiple ICICI Prudential Mutual Fund schemes. The fund raise is expected to strengthen the company's balance sheet, support expansion plans, and boost long-term growth prospects while broadening its institutional shareholder base.

ABSLPSEALPHAALPHAETFALPL30IETFAONEGOLDAONELIQUIDAONENIFTYAONESILVERAONETOTALAUTOBEESAUTOIETFAXISBPSETFBANK10ADDBANKADDBANKBETFBANKETFBANKIETFBANKPSUBBETF0432BBNPNBETFBBNPPGOLDBFSIBLUEJETBNKETFAXISBSE500IETFCASHIETFCHEMICALCHOICEGOLDCOMMOIETFCONSUMAXISCONSUMIETFDEFENCEDIVIDENDEBANKNIFTYEBBETF0430EBBETF0431EBBETF0433ECAPINSUREEGOLDELIQUIDELM250ENERGYENIFTYEQUAL200EQUAL50EQUAL50ADDESENSEXESGESILVEREVIETFFINIETFFLEXIADDFMCGADDFMCGIETFGILT10BETAGILT5BETAGOLD1GOLD360GOLDADDGOLDAXISGOLDBETAGOLDBNDGOLDETFGOLDIETFGROWWCAPMGROWWCHEMGROWWDEFNCGROWWEVGROWWGOLDGROWWHOSPIGROWWLIQIDGROWWLOVOLGROWWMC150GROWWMETALGROWWMOM50GROWWN200GROWWNETGROWWNIFTYGROWWNXT50GROWWPOWERGROWWPSEGROWWPSUBKGROWWRAILGROWWRLTYGROWWSC250GROWWSLVRGSEC10IETFGSEC10YEARGSEC5IETFHCGHCG-REHDFCGOLDHDFCGROWTHHDFCLOWVOLHDFCMID150HDFCMOMENTHDFCNEXT50HDFCNIF100HDFCNIFITHDFCPSUBKHDFCPVTBANHDFCQUALHDFCSILVERHDFCSML250HDFCVALUEHEALTHADDHEALTHAXISHEALTHCAREHEALTHIETFHSBCGOLDICICIAMCICICIB22ICICIPRULIINFRAIETFINTERNETITADDITAXISITBEESITBETAITETFITIETFLICNETFSENLICNMID100LIQGRWBEESLIQUIDLIQUID1LIQUIDIETFLIQUIDPLUSLIQUIDSBILIQUIDSHRILOWVOLLOWVOLIETFLTGILTBEESMAFANGMAHKTECHMAKEINDIAMANUFGBEESMASPTOP50METALMETALIETFMID150MIDCAPADDMIDCAPBETAMIDCAPETFMIDCAPIETFMIDQ50ADDMIDSELIETFMNCMOALPHA50MOBANK10MOCAPITALMODEFENCEMOENERGYMOGOLDMOGSECMOHEALTHMOINFRAMOIPOMOLOWVOLMOM100MOM30IETFMOM50MOMENTUMMOMENTUM30MOMENTUM50MOMGFMOMIDMTMMOMNCMOMOMENTUMMON100MON50EQUALMONEXT50MONIFTY100MONIFTY500MONQ50MOPSEMOQUALITYMOREALTYMOSERVICEMOSILVERMOSMALL250MOTOURMOVALUEMSCIADDMSCIINDIAMULTICAPNEXT30ADDNEXT50NEXT50ADDNEXT50BETANEXT50ETFNEXT50IETFNIF100IETFNIFTY100EWNIFTYADDNIFTYAXISNIFTYBETFNIFTYETFNIFTYIETFNIFTYQLITYNV20IETFOILIETFPHARMABEESPSUBANKADDPSUBNKIETFPVTBANIETFPVTBANKADDQUAL30IETFQUALITY30SBIBPBSBIETFCONSBIETFITSBIETFPBSBIETFQLTYSBILIQETFSBINEQWETFSBINMID150SBISILVERSELECTIPOSENSEXAXISSENSEXETFSENSEXIETFSETF10GILTSILVERSILVER1SILVER360SILVERADDSILVERAGSILVERAXISSILVERBEESSILVERBETASILVERBNDSILVERIETFSMALL250SMALLADDSNXT30BEESTATAGOLDTATSILVTECHTNIDETFTOP10ADDTOP15IETFTOP20TWCGOLDETFUNIONGOLDVAL30IETFVALUEVALUEAXISFinancial ServicesHealthcare
Stocks to buy or sell: Dharmesh Shah of ICICI Sec suggests buying Shriram Finance, Piramal Pharma shares on 6 July
positive
LiveMint - Markets 5d ago

Stocks to buy or sell: Dharmesh Shah of ICICI Sec suggests buying Shriram Finance, Piramal Pharma shares on 6 July

Indian benchmark indices, Sensex and Nifty 50, opened higher on July 6, driven by gains in private banking stocks following strong quarterly updates from HDFC Bank and Axis Bank. Market breadth was positive with 14 of the 16 major indices in the green.

ABSLBANETFALPL30IETFAONETMMQ50AONETOTALAUBANKAUTOIETFAXISBANKAXISBPSETFBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBNKETFAXISCAPITALSFBCOMMOIETFCONSUMAXISCONSUMIETFEBANKNIFTYEQUITASBNKESAFSFBEVIETFFINIETFFMCGIETFGILT10BETAGILT5BETAGILT5YBEESGROWWPSUBKGSEC10IETFGSEC10YEARGSEC5IETFHDFCBANKHDFCGROWTHHDFCLIQUIDHDFCMID150HDFCNEXT50HDFCNIF100HDFCNIFBANHDFCNIFITHDFCNIFTYHDFCPSUBKHDFCPVTBANHDFCSENSEXHDFCSML250HEALTHAXISHEALTHIETFICICIBANKINDIANBINFRAIETFIOBIRFCITAXISITIETFJSFBLIQUIDSHRILOWVOLIETFLTFLTGILTBEESLTGILTCASEMETALIETFMIDCAPIETFMOCAPITALMOM30IETFMUFINNEXT50IETFNIF100IETFNIFTYAXISNIFTYIETFNPBETOILIETFPHARMABEESPIRAMALFINPPLPHARMAPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDQUAL30IETFSENSEXAXISSENSEXIETFSETFNIFBKSHAHSHRIRAMFINSOUTHBANKSURYODAYTOP15IETFUJJIVANSFBUTKARSHBNKCapital GoodsFinancial Services
Prudential HCL Health gets IRDAI licence, becomes India’s 8th standalone health insurer
neutral
CNBC TV18 - Markets 9d ago

Prudential HCL Health gets IRDAI licence, becomes India’s 8th standalone health insurer

Prudential HCL Health Insurance gets IRDAI nod as a standalone health insurer, marking India's third new insurance entrant of 2026.

EVIETFHCLTECHICICIPRULIMEDANTANIVABUPASTARHEALTHFinancial ServicesHealthcare
Prudential HCL Health Insurance gets IRDAI nod
positive
ET Markets - Stocks 9d ago

Prudential HCL Health Insurance gets IRDAI nod

India's health insurance sector welcomes a new player as Prudential HCL Health Insurance receives regulatory approval. This joint venture, backed by Prudential Group Holdings and HCL Group, aims to tap into the growing demand for medical cover. The approval also signals broader regulatory changes, including new accounting standards and a policyholder protection fund. Prudential's presence in India is significantly expanding with this new health insurance arm.

AUTOIETFCOMMOIETFECAPINSUREESGEVIETFFINIETFFMCGIETFGROWWEVGSEC10IETFHCLTECHHEALTHIETFICICIB22ICICIPRULIINFRAIETFITIETFMEDANTAMETALIETFMIDCAPIETFMOM30IETFMOSERVICENEXT50IETFNIVABUPAOILIETFPSUBNKIETFSILVERIETFSTARHEALTHVAL30IETFFinancial ServicesHealthcare
Elara Securities turns bullish on banks, power, IT after market correction
positive
CNBC TV18 - Markets 10d ago

Elara Securities turns bullish on banks, power, IT after market correction

Bino Pathiparampil, Head of Research, Elara Securities (India), says Indian markets are nearing a medium-term bottom after a prolonged correction and is turning constructive on banks, power, select new-age companies, IT and real estate. While pharma remains a defensive bet, he expects margin pressure to limit near-term outperformance. He also believes IT stocks are gradually pricing in AI-led headwinds, making it a good time to start accumulating quality names.

ABRELAONETMMQ50CONSUMEREVIETFEVINDIAGROWWEVGVPILQPOWERSPARCTRELCapital GoodsFinancial Services
Sensex rises 291 points, Nifty tops 24,100: 5 key drivers behind the market rally
positive
CNBC TV18 - Markets 19d ago

Sensex rises 291 points, Nifty tops 24,100: 5 key drivers behind the market rally

Sensex rose 291 to 77094, Nifty gained 90 to 24102, led by HDFC Bank, ICICI Bank, Reliance Industries, Infosys, with IT and pharma stocks like Cipla outperforming

ABSLBANETFALPL30IETFAONETMMQ50AONETOTALAUTOIETFBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBNKETFAXISCIPLACOMMOIETFCONSUMIETFEBANKNIFTYESGEVIETFFINIETFFMCGIETFGROWWPSUBKGSEC10IETFGSEC5IETFHDFCBANKHDFCGROWTHHDFCLIQUIDHDFCMID150HDFCNEXT50HDFCNIF100HDFCNIFBANHDFCNIFITHDFCNIFTYHDFCPSUBKHDFCPVTBANHDFCSENSEXHDFCSML250HEALTHIETFICICIBANKINFRAIETFINFYITIETFLICNFNHGPLICNMID100LOWVOLLOWVOL1LOWVOLIETFMETALIETFMIDCAPIETFMIDSMALLMOCAPITALMOM30IETFMONIFTY100NEXT50IETFNIF100BEESNIF100IETFNIFTY100EWNIFTYIETFNPBETOILIETFPHARMABEESPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDQUAL30IETFRELIANCERELINFRASENSEXIETFSETFNIFBKSMALLCAPSML100CASETOP100CASETOP15IETFFinancial ServicesHealthcare
HealthQuad looking at deeper opportunities in new age healthcare with its Fund III
positive
LiveMint - Companies 22d ago

HealthQuad looking at deeper opportunities in new age healthcare with its Fund III

The early growth investor sees a wider and deeper opportunity across new age healthcare models, as demand and the pipeline of entrepreneurs building stronger, lasting businesses continues to grow

AONELIQUIDBBETF0432CONSUMEREVIETFEVINDIAGROWWEVHCGHCG-REHDFCGROWTHHEALTHADDHEALTHAXISHEALTHCAREHEALTHIETFLIQGRWBEESLIQUIDPLUSMOGSECMOHEALTHSBILIQETFFinancial ServicesHealthcare
Cipla wants new-age medicines to contribute 10% of revenue in five years
positive
CNBC TV18 - Markets 31d ago

Cipla wants new-age medicines to contribute 10% of revenue in five years

Cipla is expanding its innovation ambitions while building manufacturing capacity in the US, as the drugmaker looks to diversify revenue streams and strengthen supply-chain resilience amid increasing regulatory and localisation pressures in global pharmaceutical markets.

BMETRICSCIPLACONSUMEREVIETFEVINDIAGLOBALGROWWEVTVSSCSConsumer ServicesFinancial Services
A new-age thirst for beverages is emerging as a key force in India's consumer goods market
positive
ET Markets - Industry 32d ago

A new-age thirst for beverages is emerging as a key force in India's consumer goods market

Beverage industry in India: Indian companies are seeing strong growth in drinks like coffee, ready-to-drink options, and protein beverages. Younger consumers are driving this trend, seeking convenience and health. Companies are expanding their offerings to meet this demand. This shift presents significant opportunities for future expansion in the Indian beverage market.

CONSUMEREVIETFEVINDIAFELFELDVRFMNLGROWWEVMEDANTAVINCOFEConsumer ServicesFinancial Services
7 most valued firms' mcap eroded ₹1.25 trn last week, RIL took biggest hit
negative
Business Standard - Markets 34d ago

7 most valued firms' mcap eroded ₹1.25 trn last week, RIL took biggest hit

The combined market valuation of seven of the top-10 most-valued firms eroded by Rs 1.25 lakh crore last week, with Reliance Industries taking the biggest hit, in-line with a bearish trend in equities. Last week, the BSE benchmark Sensex declined 532.4 points, or 0.71 per cent, and the NSE Nifty dipped 181.05 points, or 0.76 per cent. "Persistent FII selling remained the key drag on market sentiment despite supportive developments such as cooling crude oil prices and a recovery in the rupee against the US dollar. Concerns regarding the pace of monsoon advancement also weighed on investor confidence," Santosh Meena, Head of Research at Swastika Investmart Ltd, said. From the top-10 pack, Reliance Industries, Bharti Airtel, Tata Consultancy Services (TCS), Bajaj Finance, Larsen & Toubro, Life Insurance Corporation of India (LIC) and Hindustan Unilever faced erosion from their valuation, while HDFC Bank, ICICI Bank, and State Bank of India were the gainers. The market valuation of ...

ABSL10BANKABSLBANETFABSLNN50ETABSLPSEALPL30IETFAONETMMQ50AONETOTALAUBANKAUTOIETFBAJAJHFLBAJFINANCEBANK10ADDBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBHARTIARTLBNKETFAXISBSEBSE500IETFBSLNIFTYBSLSENETFGCANHLIFECAPITALSFBCASHIETFCOMMOIETFCONSUMIETFDOLLAREBANKNIFTYECAPINSUREEQUITASBNKESAFSFBESENSEXEVIETFFINIETFFMCGIETFGILT10BETAGILT5BETAGILT5YBEESGROWWPSUBKGSEC10IETFGSEC5IETFHDFCBANKHDFCBSE500HDFCGROWTHHDFCLIFEHDFCLIQUIDHDFCMID150HDFCNEXT50HDFCNIF100HDFCNIFBANHDFCNIFITHDFCNIFTYHDFCPSUBKHDFCPVTBANHDFCSENSEXHDFCSML250HEALTHIETFHEALTHYHINDOILEXPHINDUNILVRICICIBANKICICIGIICICIPRULIINFRAIETFITIETFJLHLJSFBLICHSGFINLICILICNETFN50LICNETFSENLICNFNHGPLICNMID100LIQUIDBETFLIQUIDIETFLOWVOLIETFLTLTFMETALIETFMIDCAPIETFMIDSELIETFMOBANK10MOCAPITALMOM30IETFMOMENTUMNETFNEXT30ADDNEXT50IETFNIF100IETFNIFTYBETFNIFTYIETFNIFTYQLITYNPBETOILOILIETFPERSISTENTPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDQUAL30IETFRELIANCERELINFRARHFLSBIBPBSBILIFESBINSDL26BEESSENSEXADDSENSEXAXISSENSEXBETASENSEXETFSENSEXIETFSETFNIFBKSNXT30BEESSNXT50BETASURYODAYTATATECHTCSTECHTNIDETFTOP10ADDTOP15IETFTOP20UJJIVANSFBUTKARSHBNKConstructionFast Moving Consumer Goods
Rajesh Exports, Tata Motors PV, Auro Pharma, ICICI Bank and more: Stocks to Watch for June 5
positive
CNBC TV18 - Markets 37d ago

Rajesh Exports, Tata Motors PV, Auro Pharma, ICICI Bank and more: Stocks to Watch for June 5

Rajesh Exports defends disclosures after SEBI concerns, Tata Motors targets over 20% PV share by 2030, ICICI Bank gets SEBI warning, Aurobindo wins US FDA nod, CG Power starts new EHV unit. Here are few stocks to track ahead of Friday's trading session.

AUROPHARMABANKIETFBANKINDIAEVIETFFINIETFGVPILICICIBANKNPBETPSUBNKIETFPVTBANIETFRAJESHEXPOTATAPOWERTATATECHTMCVTMPVAutomobile and Auto ComponentsCapital Goods
Stocks to buy today: Sudeep Pharma, Rubicon Research, ICICI Prudential AMC
positive
Business Standard - Markets 40d ago

Stocks to buy today: Sudeep Pharma, Rubicon Research, ICICI Prudential AMC

Stocks to buy today: Aakash Shah of Choice Broking has recommended buying three stocks today - Rubicon Research, Sudeep Pharma, and ICICI Prudential Asset Management.

AAKASHALPL30IETFAUTOIETFBANKIETFBSE500IETFCASHIETFCHOICEINCOMMOIETFCONSUMIETFCRAMCEVIETFFINIETFFMCGIETFGOLDIETFGSEC10IETFGSEC5IETFHDFCAMCHEALTHIETFICICIAMCICICIB22ICICIPRULIINFRAIETFITIETFJAROLIQUIDIETFLOWVOLIETFMETALIETFMIDCAPIETFMIDSELIETFMOM30IETFNAM-INDIANEXT50IETFNIF100IETFNIFTYIETFNV20IETFOILIETFPSUBNKIETFPVTBANIETFQUAL30IETFRUBICONSENSEXIETFSHAHSILVERIETFSPARCSUDEEPPHRMTOP15IETFUTIAMCVAL30IETFCapital GoodsConsumer Services
Next