Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:PREMIUMHealthcare
Clear all filters
General insurers clock 16.7% premium growth
positive
ET Markets - Stocks 3d ago

General insurers clock 16.7% premium growth

The general insurance sector saw a 16.7% premium income rise in June. Standalone health insurers led this growth with a 31% increase. First quarter collections for FY27 also climbed by 11.1%. Niva Bupa Health Insurance showed strong premium growth of 34% in June. ICICI Lombard General Insurance reported a 13.7% premium increase for the month.

CASHIETFGICREGODIGITICICIGIICICIPRULIMEDANTANIVABUPAPREMIUMSTARHEALTHAutomobile and Auto ComponentsFinancial Services
General insurance premiums rise 14% in June; health insurers clock 31% growth
positive
CNBC TV18 - Markets 4d ago

General insurance premiums rise 14% in June; health insurers clock 31% growth

Niva Bupa Health Insurance outperformed the segment, reporting 35% growth in premium collections, while Star Health and Allied Insurance recorded a 19% increase.

GICREGODIGITICICIGIMEDANTANIVABUPAPREMIUMSTARSTARHEALTHAutomobile and Auto ComponentsFinancial Services
Star Plus bets big on premium non-fiction as broadcasters chase new audiences, advertiser interest
positive
ET Markets - Industry 4d ago

Star Plus bets big on premium non-fiction as broadcasters chase new audiences, advertiser interest

Star Plus is strategically re-entering premium non-fiction programming after a long hiatus. The channel has launched India Ke Top 1%, an adaptation of a global quiz show. This move aims to attract wider audiences and deepen viewer engagement. Non-fiction formats offer richer integration opportunities for advertisers and brands. The channel will evaluate future non-fiction investments based on audience reception.

FELFELDVRGLOBALPREMIUMSTARAutomobile and Auto ComponentsConsumer Services
Broadcasters, streamers step up investment in premium non-fiction content
positive
ET Markets - Industry 4d ago

Broadcasters, streamers step up investment in premium non-fiction content

Indian broadcasters and streaming platforms are significantly increasing investment in premium non-fiction content. Unscripted programming now accounts for nearly thirty percent of all content across platforms. Companies are betting on reality and comedy formats to attract viewers and build franchises. Netflix and Prime Video are expanding their unscripted content with homegrown and international shows. Broadcasters like Star Plus and Sony are also strengthening their non-fiction offerings to boost viewership.

ALLETECBFINVESTPREMIUMSTARAutomobile and Auto ComponentsFinancial Services
Mother Sparsh sees up to 40% growth as baby-care boom defies consumer slowdown
positive
ET Markets - Industry 8d ago

Mother Sparsh sees up to 40% growth as baby-care boom defies consumer slowdown

Mother Sparsh anticipates a robust 30-40% revenue surge this year, defying broader consumption slowdowns. Indian parents are prioritizing their babies' health and well-being, investing in premium, 'no nasties' products. Leveraging ITC's extensive distribution, the brand aims to expand its reach beyond online channels into smaller cities, tapping into a growing demand for trusted, scientifically-backed baby care solutions.

AGARWALEYEAMRUTANJANBAJAJCONCONSUMERGANESHCPGODREJCPITCIWPJUBLCPLLIBASMEDANTAMOGSECPGHHPREMIUMTATACONSUMZOTAAutomobile and Auto ComponentsChemicals
Cracks in cola kingdom: India's duopoly faces biggest test in decades
neutral
ET Markets - Industry 9d ago

Cracks in cola kingdom: India's duopoly faces biggest test in decades

India's cola market is undergoing a significant transformation, moving beyond the traditional Coca-Cola vs. PepsiCo rivalry. Reliance's Campa revival ignited a price war, while ITC's new premium, sugar-free coconut cola signals a shift towards health, premiumization, and niche offerings. This evolving landscape caters to health-conscious consumers seeking alternatives, indicating a more dynamic and diversified future for the Indian beverage sector.

DYNAMICFELFELDVRFMNLITCMEDANTAPREMIUMRELIANCERELINFRAAutomobile and Auto ComponentsConsumer Services
ITC enters cola business to add more fizz to beverages portfolio
positive
ET Markets - Industry 9d ago

ITC enters cola business to add more fizz to beverages portfolio

India's carbonated soft drinks market is intensifying as ITC launches a premium sugar-free Coconut Cola, aiming to compete with global giants Coca-Cola and PepsiCo. This move follows Reliance Industries' aggressive pricing strategy with its revived Campa brand. ITC plans to expand its beverage offerings, focusing on the premium, health-conscious segment, which is experiencing rapid growth due to increasing consumer preference for low- and no-sugar options.

CONSUMERGLOBALITCMEDANTAPREMIUMRELIANCERELINFRAAutomobile and Auto ComponentsConsumer Services
Top Five Reasons Health Insurance Claims Are Rejected: All That Policyholder Should Know
negative
NDTV Profit 11d ago

Top Five Reasons Health Insurance Claims Are Rejected: All That Policyholder Should Know

Some health insurance policies may appear attractive because they are available at a lower premium.

ALLETECMEDANTANIVABUPAPREMIUMSTARHEALTHAutomobile and Auto ComponentsFinancial Services
Chips or chocolates, India's brands want you to pay more for a fitter you
positive
ET Markets - Industry 15d ago

Chips or chocolates, India's brands want you to pay more for a fitter you

From millet chips and protein-rich chocolates to science-backed skincare, FMCG companies are increasingly premiumising everyday products to drive growth beyond volumes. Backed by rising demand for health, nutrition and convenience, brands are leveraging trusted names to launch higher-margin variants, while industry data shows premium categories continuing to outpace the broader market despite concerns over whether healthier claims always translate into better nutrition.

MEDANTAPREMIUMSHANTHALAAutomobile and Auto ComponentsFast Moving Consumer Goods
Godrej, Blue Star See Premium Push After Voltas' 1-Million-AC Sales Signal Strong Summer Demand
positive
NDTV Profit 15d ago

Godrej, Blue Star See Premium Push After Voltas' 1-Million-AC Sales Signal Strong Summer Demand

Representational

BLUESTARCOGODREJINDPREMIUMSTARVOLTASAutomobile and Auto ComponentsConsumer Durables
Zydus Lifesciences, 2 other share buybacks closing today. Are you participating?
positive
ET Markets - Stocks 31d ago

Zydus Lifesciences, 2 other share buybacks closing today. Are you participating?

Investors have a final opportunity to tender shares in buyback offers from Zydus Lifesciences, Dhanuka Agritech, and CyberTech Systems and Software. These offers, collectively valued at approximately Rs 1,185 crore, are closing on Wednesday. Eligible shareholders can participate in these corporate actions, which represent a chance to sell shares at a premium.

AGRITECHCYBERTECHDHANUKAPREMIUMRSSOFTWARERSYSTEMSZYDUSLIFEAutomobile and Auto ComponentsChemicals
Indian aviation market offers long-term opportunities: Star Alliance CEO
positive
ET Markets - Industry 32d ago

Indian aviation market offers long-term opportunities: Star Alliance CEO

India's aviation market presents significant long-term opportunities. Air India is poised to benefit from this growth. Demand for premium leisure travel is rising globally and in India. Star Alliance members are adapting to this trend. Air India's transformation is progressing well with Star Alliance support.

LTGILTBEESPREMIUMSTARAutomobile and Auto ComponentsFinancial Services
Next