Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:BMETRICSInformation Technology
Clear all filters
NEWS
positive
Business Standard - Markets 3d ago

Handloom Hackathon 2026 Launched to Drive Innovation, Sustainability and Technology Solutions for India's Handloom Sector

The Hackathon has been designed to encourage innovative solutions across a broad range of thematic areas, including product and design innovation, sustainability and circularity, digital technologies, market access, branding, supply chain efficiency, productivity enhancement, business development and social impact. The initiative seeks to foster closer collaboration between the handloom ecosystem and Indias innovation and startup ecosystem, while encouraging interdisciplinary problem-solving.

BMETRICSEQUIPPPTVSSCSInformation TechnologyServices
PS5 runs out faster on GTA VI rush amid demand to upgrade consoles
positive
ET Markets - Industry 6d ago

PS5 runs out faster on GTA VI rush amid demand to upgrade consoles

The highly anticipated Grand Theft Auto VI pre-orders have ignited a frenzy for PlayStation 5 consoles, with stock vanishing rapidly. Retailers report PS5s selling out within days, driven by the game's exclusive launch on current-gen consoles and Sony's strong marketing push. This surge, impacting all sales channels, shows the immense gamer demand clashing with ongoing supply chain issues.

ALLETECAMBAAUTOBMETRICSCURRENTTVSSCSAutomobile and Auto ComponentsConstruction
Strict Milk Safety Norms In Maharashtra; FDA To Slap Rs 10 Lakh Fine On Violations
positive
NDTV Profit 8d ago

Strict Milk Safety Norms In Maharashtra; FDA To Slap Rs 10 Lakh Fine On Violations

According to Mundhe, all phases of the milk supply chain are covered by the new regulations.

ALLETECBMETRICSTVSSCSInformation TechnologyServices
Maersk places order for 1,000 shipping containers with DCM Shriram Group
positive
ET Markets - Industry 8d ago

Maersk places order for 1,000 shipping containers with DCM Shriram Group

Global shipping giant AP Moller-Maersk has ordered 1,000 more India-made shipping containers from DCM Shriram Group. Union Minister Sarbananda Sonowal unveiled the first such container, marking a significant step towards self-reliance in maritime manufacturing. This partnership is set to boost India's global supply chain presence and manufacturing capabilities, supported by government initiatives promoting domestic production.

BMETRICSCONCORDCMDCMSHRIRAMDCMSILDCMSRINDDSFCLGLOBALRELIANCERELINFRASCITVSSCSChemicalsConsumer Services
FDA issues compliance order for milk sector in Maharashtra; warns of Rs 10 lakh fine for violations
neutral
ET Markets - Industry 8d ago

FDA issues compliance order for milk sector in Maharashtra; warns of Rs 10 lakh fine for violations

Maharashtra FDA has mandated strict food safety compliance across the entire milk supply chain, from farms to retailers. New guidelines aim to prevent adulteration and ensure uniform standards. Violations like operating without licenses or making false claims can now incur fines up to Rs 10 lakh. The FDA emphasized accountability for all stakeholders, including transporters, and warned of license cancellations for non-compliance, following similar actions in the hospitality sector.

ALLETECBMETRICSTVSSCSInformation TechnologyServices
Flipkart appoints Vinay Vaidya as senior vice president of technology for supply chain
positive
ET Markets - Industry 9d ago

Flipkart appoints Vinay Vaidya as senior vice president of technology for supply chain

Flipkart has appointed Vinay Vaidya as Senior Vice President of Technology for its supply chain, bringing over two decades of experience from Amazon and Tata Digital. Vaidya will spearhead technology and innovation across key areas, including logistics and AI. This strategic hire follows a series of other significant senior appointments aimed at bolstering Flipkart's technological capabilities for future expansion.

BMETRICSFELFELDVRSJLOGISTICTATATECHTNIDETFTVSSCSConsumer ServicesFinancial Services
Flipkart names Vinay Vaidya as senior VP to bolster tech leadership
positive
ET Markets - Industry 9d ago

Flipkart names Vinay Vaidya as senior VP to bolster tech leadership

Flipkart has appointed Vinay Vaidya as Senior Vice President of Technology for its supply chain, aiming to bolster its tech leadership and advance AI and platform capabilities. Vaidya, with extensive experience from Amazon and Tata Digital, will oversee technology across fulfilment, seller experience, and marketplace operations.

ADVANCEBMETRICSTATATECHTECHTNIDETFTVSSCSZTECHChemicalsFinancial Services
NEWS
negative
Business Standard - Markets 11d ago

India's sound macroeconomic fundamentals provide greater resilience to external shocks, says RBI

Reserve Bank released the June 2026 edition of the Financial Stability Report (FSR) today. It noted that despite repeated shocks, the global financial system has thus far demonstrated notable resilience, with markets remaining orderly after an initial bout of volatility following the outbreak of the West Asia conflict. Nevertheless, global financial stability risks remain elevated. Persistent supply chain uncertainties could tighten financial conditions and revive inflationary pressures. Meanwhile, elevated public debt, bond market fragilities, stretched asset valuations, and leveraged NBFIs remain key vulnerabilities that could amplify future shocks.

AXISBPSETFBANKETFBANKINDIABANKPSUBFSIBMETRICSFELFELDVRFMNLGLOBALJMFINANCILLOWVOLPERSISTENTTVSSCSConsumer ServicesFinancial Services
Apple iPhone 18 Pro supplier list, parts and photos exposed in Tata data leak
negative
ET Markets - Industry 11d ago

Apple iPhone 18 Pro supplier list, parts and photos exposed in Tata data leak

Sensitive data, including component lists and photos of upcoming iPhone 18 Pro models, has been leaked onto the dark web by a ransomware group targeting Tata Electronics, Apple's Indian supplier. This breach exposes crucial details about Apple's supply chain, potentially impacting its business relationships and revealing manufacturing secrets to rivals. The leak occurs as India's role in iPhone production significantly expands.

BMETRICSLGEINDIATATATECHTVSSCSConsumer DurablesInformation Technology
Home sales fall to three-year low in June quarter
negative
ET Markets - Industry 11d ago

Home sales fall to three-year low in June quarter

Home sales experienced a notable dip in the June quarter, marking the slowest performance since early 2023. Persistent global uncertainties and supply chain issues have dampened buyer sentiment. Despite this, new project launches saw an annual increase, particularly in premium segments and infrastructure-driven areas. While most major cities saw sales decline, Kolkata, Hyderabad, and Bengaluru registered modest yearly growth.

BMETRICSGLOBALMOGSECPERSISTENTPREMIUMTVSSCSAutomobile and Auto ComponentsConsumer Services
At Sid’s Farm, the pursuit of milk begins with uncompromising standards
positive
ET Markets - Industry 15d ago

At Sid’s Farm, the pursuit of milk begins with uncompromising standards

Sid's Farm is strengthening consumer trust through rigorous daily quality checks and a parent-first approach to dairy production. The company invests over ₹15 lakh every month in antibiotic residue testing while rewarding farmers for maintaining quality standards. Its #HoldUsToIt campaign encourages consumers to question and verify its practices, promoting transparency over traditional brand promises. By aligning supply-chain integrity with food safety, Sid’s Farm aims to set a new benchmark for trust in India's dairy sector.

BMETRICSCONSUMERINTEGRITYTRUSTTVSSCSConstructionFinancial Services
India needs to diversify its sources of energy needs, says NITI vice-chairman
positive
ET Markets - Industry 18d ago

India needs to diversify its sources of energy needs, says NITI vice-chairman

NITI Aayog Vice Chairman Ashok Kumar Lahiri highlighted that the West Asia conflict, though a temporary supply chain issue, underscores India's need to diversify energy sources. He expressed optimism about an upcoming India-US trade agreement and advocated for including pharmaceutical products in future FTAs. Lahiri likened the crisis to a manageable 'influenza,' emphasizing the lesson of not concentrating all import and export dependencies.

ALLETECBMETRICSENERGYFELFELDVRGKENERGYKPELSKMEGGPRODTVSSCSConstructionConsumer Services
Next