Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:GKENERGYInformation Technology
Clear all filters
NEWS
positive
Business Standard - Markets 3h ago

JSW Energy to acquire Chhattisgarh-based thermal power plant operator Maruti Clean Coal & Power

JSW Energy said that it has signed a definitive agreement with Kolahai Infotech and SFI Parcel Services to acquire 100% equity shares of Maruti Clean Coal & Power (MCCPL).

3IINFOLTDCLEANCLEANMAXCOALINDIADPELENERGYGKENERGYGVPILJSWENERGYJSWHLJSWINFRAKPELMARUTIAutomobile and Auto ComponentsCapital Goods
NEWS
positive
Business Standard - Markets 2d ago

Rane Steering Systems to acquire 26% stake in Hexa Energy BH Eleven

BGRENERGYENERGYGKENERGYKPELRANEHOLDINRSYSTEMSSWELECTESCapital GoodsConstruction
MTAR Tech share price falls 11% as US client faces project uncertainty
positive
Business Standard - Markets 2d ago

MTAR Tech share price falls 11% as US client faces project uncertainty

The sharp decline in MTAR Technologies shares today followed reports that Crusoe Energy Systems LLC has paused work on a project in Wyoming, for which Bloom Energy was contracted as fuel cell supplier

BGRENERGYENERGYGKENERGYKPELMTARTECHRSYSTEMSSWELECTESTECHZTECHCapital GoodsConstruction
Gold slumps most in two months as jobs fuel Fed rate-hike bets
positive
CNBC TV18 - Markets 7d ago

Gold slumps most in two months as jobs fuel Fed rate-hike bets

Bullion declined as much as 3.4% as bond yields and the dollar climbed after the latest US data showed job growth topped all forecasts in May. The strength in the labour market keeps the door open for Fed officials to hike rates as Middle East tensions fuel higher energy prices.

ALLETECAONELIQUIDBBETF0432BSLGOLDETFCASHIETFDOLLARENERGYGKENERGYHDFCLIQUIDKPELLIQGRWBEESLIQUIDBETFLIQUIDPLUSSBILIQETFConstructionFinancial Services
NEWS
positive
Business Standard - Markets 8d ago

INR appreciates under Rs 95 per dollar after RBI announces measures to support foreign capital inflows and strengthen forex liquidity

The Indian rupee appreciated 81 paise to close at 94.93 (provisional) against the US dollar on Friday after the Reserve Bank announced measures to support foreign capital inflows and strengthen forex liquidity. The announcements in the RBI policy boosted investor sentiments after the apex bank asserted that the country's forex reserves provide a sufficient buffer against external shocks. The Reserve Bank on Friday expectedly kept interest rates unchanged for the second time in a row as it weighed the impact of rising energy prices and supply disruptions caused by the West Asia crisis. The RBI kept its repo rate Steady at 5.25% amid uncertainty owing to US-Iran War. However, it expanded the Fully Accessible Route, or FAR, to include all new 15-year, 30-year and 40-year government security issuances. Due to this, the foreign investors will get wider access to longer-tenor Indian government bonds. This also opens up more room to invest in Indias bond market. The central bank has also ...

AKCAPITALLETECALLTIMEAPEXBANKINDIACAPITALSFBCENTRALBKCPCAPDOLLARENERGYGKENERGYIEXINDIANBIOBIREDAKPELMOCAPITALROUTESOUTHBANKConstructionConsumer Durables
NEWS
negative
Business Standard - Markets 8d ago

Jagran Prakashan Ltd leads losers in 'B' group

Suven Life Sciences Ltd, Ravindra Energy Ltd, Sunflag Iron & Steel Company Ltd and Exicom Tele-Systems Ltd are among the other losers in the BSE's 'B' group today, 05 June 2026.

ABSL10BANKALIVUSBGRENERGYBSEBSLSENETFGENERGYEXICOMGKENERGYJAGRANJFLLIFEJFL-REKPELRELTDRPGLIFERSYSTEMSSAILIFESALSTEELSUNFLAGSUVENSWELECTESVRAJCapital GoodsConstruction
Jain Irrigation, Ankur Scientific partner on agri waste-to-energy project in Maharashtra
positive
ET Markets - Industry 8d ago

Jain Irrigation, Ankur Scientific partner on agri waste-to-energy project in Maharashtra

Jain Irrigation Systems Ltd and Ankur Scientific are joining forces for a new project in Jalgaon, Maharashtra. This initiative will convert farm waste into thermal energy and biochar. Farmers will gain an extra income source from their crop residue. The plant will process nearly 50 tonnes of agricultural biomass daily.

BGRENERGYENERGYGKENERGYJISLDVREQSJISLJALEQSKPELPOLYSILRSYSTEMSSWELECTESCapital GoodsConstruction
NEWS
positive
Business Standard - Markets 8d ago

INR regains momentum with all eyes on RBI monetary policy

The Indian rupee is regaining some momentum in opening trades on Friday as the global crude oil prices eased and market participants keenly awaited the RBI's MPC decision today. Heightened geopolitical tensions between the US and Iran drove energy volatility and aggressive safe-haven buying capped sharp gains in the local unit. INR opened at Rs 95.72 per dollar and hit a high of 95.63 so far during the day. Yesterday, rupee depreciated 7 paise to close at 95.83 against the US dollar. Local markets opened in the green with investors closely watching the Reserve Bank of India (RBI) monetary policy announcement scheduled for today. The Indian benchmark indices are trading higher today, with the NIFTY 50 hovering around 23,442.30 (+0.11%) and the S&P BSE SENSEX trading at 74,556.68 (+0.26%).

ABSLBANETFADANIGREENALLETECALPL30IETFAONETMMQ50AONETOTALAXISBNKETFAXSENSEXBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBSEBSLSENETFGDOLLAREBANKNIFTYECAPINSUREENERGYESENSEXFINIETFGILT10BETAGILT5BETAGILT5YBEESGKENERGYGLOBALGROWWCAPMGROWWLOVOLGROWWMOM50GROWWPSUBKGSEC10IETFGSEC5IETFHDFCNIFBANHDFCPSUBKHDFCPVTBANHDFCSENSEXIEXINDIANBINOXGREENIOBIOCIREDAKPELKPIGREENLOWVOLLOWVOL1LOWVOLIETFMIDSMALLMOCAPITALMOENERGYMOLOWVOLMOM30IETFMOMENTUMMOMENTUM30MOMENTUM50MOMIDMTMMOMOMENTUMNEXT30ADDNPBETNTPCGREENOILOILIETFPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDSAATVIKGLSBIBPBSBIMIDMOMSENSEXADDSENSEXBETASENSEXETFSENSEXIETFSETFNIFBKSMALLCAPSNXT30BEESSNXT50BETASOUTHBANKCapital GoodsConstruction
NEWS
positive
Business Standard - Markets 9d ago

Tata Power Company Ltd down for fifth straight session

Tata Power Company Ltd is quoting at Rs 411, down 0.18% on the day as on 13:19 IST on the NSE. The stock jumped 4.43% in last one year as compared to a 5.65% slide in NIFTY and a 12.98% spurt in the Nifty Energy index.

AONELIQUIDAONENIFTYAONETMMQ50AONETOTALBANKIETFDPELENERGYGKENERGYGVPILKPELMOENERGYNETFNPBETPVTBANIETFTATAPOWERTATATECHTNIDETFCapital GoodsConstruction
'India to pilot hydrogen buses, trucks on 10 roads; Reliance, Tata, NTPC among partners,' says Nitin Gadkari
positive
ET Markets - Industry 9d ago

'India to pilot hydrogen buses, trucks on 10 roads; Reliance, Tata, NTPC among partners,' says Nitin Gadkari

India is launching a pilot project for hydrogen-powered buses and trucks on ten roads. Major companies like Reliance and Tata are partnering in this initiative. The country aims to become an energy exporter, moving beyond imports. This marks a significant step in India's energy transition, with flex-fuel vehicles also set for expansion.

ENERGYGKENERGYKPELNTPCNTPCGREENRELIANCERELINFRATATATECHTMPVAutomobile and Auto ComponentsConstruction
Buy, Sell Or Hold: Suzlon Energy, TCS, Blue Star, Zen Tech, Kwality Walls — Ask Profit
positive
NDTV Profit 9d ago

Buy, Sell Or Hold: Suzlon Energy, TCS, Blue Star, Zen Tech, Kwality Walls — Ask Profit

Buy Sell Hold

BLUESTARCOENERGYGKENERGYKPELSTARSUZLONTCSTECHZENTECZTECHCapital GoodsConstruction
Maruti unveils India's first flex-fuel car: What is a flex fuel vehicle? How does it work? Will it cut your fuel bill? Here's all
positive
ET Markets - Industry 9d ago

Maruti unveils India's first flex-fuel car: What is a flex fuel vehicle? How does it work? Will it cut your fuel bill? Here's all

Maruti Suzuki has introduced India's first flex-fuel passenger car. This technology allows vehicles to run on petrol or petrol-ethanol blends. It is seen as a significant step towards reducing crude oil imports. The move also aims to lower carbon emissions and enhance India's energy security. This innovation could unlock substantial benefits for the country.

ALLETECENERGYGKENERGYKPELMARUTIOILOILCOUNTUBTMPVAutomobile and Auto ComponentsConstruction
Next