Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:MEDANTAOil Gas & Consumable Fuels
Clear all filters
Sensex gains 579 points, Nifty ends above 24,150: 5 reasons why stock market rose today
positive
CNBC TV18 - Markets 9d ago

Sensex gains 579 points, Nifty ends above 24,150: 5 reasons why stock market rose today

Indian indices rose, Sensex up 579 pts, Nifty above 24,150, led by IT stocks, oil companies. Bank of Baroda fell on NMC Health settlement.

ABSLBANETFAONETMMQ50AONETOTALBANKADDBANKBARODABANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBNKETFAXISEBANKNIFTYFINIETFGROWWMC150GROWWPSUBKHDFCMID150HDFCNIFBANHDFCPSUBKHDFCPVTBANINDIANBIOBIOCMEDANTAMID150MID150BEESMID150CASEMIDCAPADDMIDCAPBETAMIDCAPETFMIDCAPIETFMIDQ50ADDMOCAPITALNPBETOILOILIETFPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDSBINMID150SETFNIFBKSOUTHBANKFinancial ServicesHealthcare
Cracks in cola kingdom: India's duopoly faces biggest test in decades
neutral
ET Markets - Industry 9d ago

Cracks in cola kingdom: India's duopoly faces biggest test in decades

India's cola market is undergoing a significant transformation, moving beyond the traditional Coca-Cola vs. PepsiCo rivalry. Reliance's Campa revival ignited a price war, while ITC's new premium, sugar-free coconut cola signals a shift towards health, premiumization, and niche offerings. This evolving landscape caters to health-conscious consumers seeking alternatives, indicating a more dynamic and diversified future for the Indian beverage sector.

DYNAMICFELFELDVRFMNLITCMEDANTAPREMIUMRELIANCERELINFRAAutomobile and Auto ComponentsConsumer Services
ITC enters cola business to add more fizz to beverages portfolio
positive
ET Markets - Industry 10d ago

ITC enters cola business to add more fizz to beverages portfolio

India's carbonated soft drinks market is intensifying as ITC launches a premium sugar-free Coconut Cola, aiming to compete with global giants Coca-Cola and PepsiCo. This move follows Reliance Industries' aggressive pricing strategy with its revived Campa brand. ITC plans to expand its beverage offerings, focusing on the premium, health-conscious segment, which is experiencing rapid growth due to increasing consumer preference for low- and no-sugar options.

CONSUMERGLOBALITCMEDANTAPREMIUMRELIANCERELINFRAAutomobile and Auto ComponentsConsumer Services
Markets ahead: West Asia tensions, crude prices key factors to watch out
negative
Business Standard - Markets 13d ago

Markets ahead: West Asia tensions, crude prices key factors to watch out

Developments on the geopolitical front, with the latest military exchanges involving the US and Iran, their impact on crude oil prices and domestic macroeconomic data announcements would dictate sentiments in the stock market this week, analysts said. Besides, trading patterns of foreign investors and progress of the southwest monsoon would also remain the key areas of focus for investors, they added. "Market participants will closely monitor Industrial Production (IIP) data, the final HSBC Manufacturing, Services and Composite PMI readings, and the foreign exchange reserves data for fresh insights into the health of the domestic economy," Ajit Mishra, SVP, Research, Religare Broking Ltd, said. Globally, the trajectory of crude oil prices and geopolitical developments in West Asia will remain key drivers of market sentiment, he said. The monthly auto sales numbers on July 1 will also be tracked by investors closely. "The week ahead is likely to be shaped by developments on the ..

AMBAAUTODATAPATTNSFOCUSMEDANTAOILRELIGARESOUTHWESTAutomobile and Auto ComponentsCapital Goods
Deep Health AI reduces stake in Exxaro Tiles to 5.98% - scanx.trade
neutral
Google News - India Markets 16d ago

Deep Health AI reduces stake in Exxaro Tiles to 5.98% - scanx.trade

Deep Health AI reduces stake in Exxaro Tiles to 5.98%scanx.trade

DEEPINDSEXXAROMEDANTAConsumer DurablesHealthcare
Fast-tracked power plants fuel AI boom, with little public scrutiny
positive
ET Markets - Industry 25d ago

Fast-tracked power plants fuel AI boom, with little public scrutiny

New power plants are being built at an unprecedented speed to meet the growing demand of tech companies. These facilities, often fueled by natural gas, are being approved with minimal public notice and environmental review. Residents are raising alarms about potential health and climate impacts. This trend is reshaping energy infrastructure across the United States.

DPELENERGYGKENERGYGVPILKPELMEDANTAONGCTECHVIVIANAZTECHCapital GoodsConstruction
Coal minister flags unregulated expansion of online pharmacies
neutral
ET Markets - Industry 46d ago

Coal minister flags unregulated expansion of online pharmacies

Union minister G Kishan Reddy has written to the health minister about concerns over online pharmacies. These platforms are accused of deep discounting and selling drugs without oversight. This practice threatens local chemists and public health. The issue highlights the need for clear e-pharmacy regulations. A nationwide strike by chemists recently demanded fair competition and stricter online drug sales rules.

COALINDIADEEPINDSMEDANTAHealthcareOil Gas & Consumable Fuels
Stocks to Watch for May 27: Coal India, JK Tyre, Siemens, HG Infra and more
positive
CNBC TV18 - Markets 46d ago

Stocks to Watch for May 27: Coal India, JK Tyre, Siemens, HG Infra and more

JK Tyre leads Q4 earnings as profits surge, while P&G Health, Siemens, Fino Payments Bank and others post mixed results and key dividend, leadership updates. Here are few stocks to track ahead of Wednesday's session.

BANKINDIACOALINDIADIVIDENDFINOPBINFRAJKTYREMEDANTASIEMENSAutomobile and Auto ComponentsCapital Goods
Petrol, diesel prices hiked by Rs 7.5 per litre since Iran war: Here’s how it will impact your daily life
neutral
ET Markets - Industry 46d ago

Petrol, diesel prices hiked by Rs 7.5 per litre since Iran war: Here’s how it will impact your daily life

Fuel prices are rising again, making travel and goods more expensive. This impacts transporters, supply chains, and household budgets. Oil Marketing Companies are seeing stock rallies. The government faces a challenge balancing OMCs' financial health with consumer impact. Global events continue to influence fuel costs.

CONSUMERGLOBALJMFINANCILMEDANTAOILConsumer ServicesFinancial Services
Q4 Results LIVE Updates: Max Health shares decline 7%, Honasa Consumer up 7%; Hindalco report today
positive
CNBC TV18 - Markets 50d ago

Q4 Results LIVE Updates: Max Health shares decline 7%, Honasa Consumer up 7%; Hindalco report today

Q4 Results Live Update: Another busy earnings week ends with three Nifty names - Sun Pharma, Eicher Motors and Hindalco reporting their results today, along with broader market names like Torrent Pharma, Fortis Healthcare, DAM Capital, Colgate-Palmolive, IRCON International, Jubilant Pharmova, Minda Corp, and many others. LG, LIC, GAIL, ITC, will also be reacting to their results reported on Thursday.

ABSLBANETFABSLNN50ETABSLPSEAKCAPITAONETMMQ50AONETOTALBSLNIFTYCOLPALCONSUMERCPCAPDAMCAPITALEICHERMOTFORTISGAILGROWWCAPMHCGHCG-REHEALTHADDHEALTHAXISHEALTHCAREHEALTHIETFHEALTHYHINDALCOHONASAIRCONITCJUBLCPLJUBLPHARMALICNETFN50LICNFNHGPLICNMID100MAXHEALTHMAXINDMEDANTAMINDACORPMOCAPITALMOMENTUMNIFTYQLITYPHARMABEESSANOFICONRSPARCTECHAutomobile and Auto ComponentsChemicals
NEWS
positive
Business Standard - Markets 67d ago

Infosys completes acquisition of Optimum Healthcare IT

The acquisition of Optimum Healthcare IT underscores Infosys' commitment to strengthening its healthcare capabilities, particularly in collaboration with health systems and provider organizations to deliver measurable outcomes across complex clinical and operational environments. Optimum Healthcare IT brings deep provider-domain expertise and a proven delivery model making it a strong strategic fit for Infosys' healthcare growth strategy. This investment significantly enhances Infosys' presence in the provider segment, adding new clients and relationships, expanding technology capabilities, and creating synergies across new buying centers. By bringing together Optimum's provider experience with Infosys Topaz and Infosys Cobalt, we are positioned to create a differentiated value proposition for healthcare providers accelerating end-to-end cloud, data, and digital transformation at scale.

BFINVESTDEEPINDSHCGHCG-REHEALTHCAREINFYMEDANTARSYSTEMSVALUEFinancial ServicesHealthcare
Deep Health AI India Limited Board Approves Rights Issue of Up to Rs. 25.00 Crores - scanx.trade
positive
Google News - India Markets 68d ago

Deep Health AI India Limited Board Approves Rights Issue of Up to Rs. 25.00 Crores - scanx.trade

Deep Health AI India Limited Board Approves Rights Issue of Up to Rs. 25.00 Croresscanx.trade

DEEPINDSMEDANTAHealthcareOil Gas & Consumable Fuels
2
Next