Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:VITALPower
Clear all filters
One attack, one warning: The world's energy lifeline is still vulnerable
negative
ET Markets - Industry 4d ago

One attack, one warning: The world's energy lifeline is still vulnerable

An attack on a Qatari LNG carrier in the Strait of Hormuz has raised concerns. This incident suggests ongoing threats to commercial shipping in the vital waterway. Energy markets may face potential repeated disruptions rather than widespread conflict fears. The dispute over Hormuz control remains unresolved, impacting global energy supplies.

ENERGYGKENERGYGLOBALKPELSCIVITALZFCVINDIAAutomobile and Auto ComponentsChemicals
Govt scraps auction of 9 critical mineral blocks citing poor investor response
neutral
ET Markets - Industry 6d ago

Govt scraps auction of 9 critical mineral blocks citing poor investor response

Government cancels auction of nine crucial mineral blocks due to poor investor interest and a lack of qualified bidders. This setback hinders efforts to boost domestic production of minerals vital for energy security and clean-tech manufacturing. The cancellations, a recurring issue in previous rounds, highlight challenges in attracting private investment to riskier mining ventures with high costs and regulatory hurdles.

BFINVESTCLEANCLEANMAXENERGYGKENERGYKPELSARDAENTECHVITALZTECHChemicalsConstruction
Coal India's SECL strengthens monsoon measures for uninterrupted supply
positive
ET Markets - Industry 9d ago

Coal India's SECL strengthens monsoon measures for uninterrupted supply

SECL, a Coal India subsidiary, has implemented robust monsoon preparedness to ensure uninterrupted coal supplies crucial for India's energy security. The company achieved its best-ever first-quarter performance in production and offtake, with a significant portion directed to power utilities. SECL's extensive operations across Chhattisgarh and Madhya Pradesh underscore its vital role in meeting national energy demands.

BFUTILITIECOALINDIADPELENERGYGKENERGYGVPILKPELMPTODAYVITALCapital GoodsChemicals
ACME-IHI JV secures $5 billion Japanese support for Odisha green ammonia project
positive
ET Markets - Industry 11d ago

ACME-IHI JV secures $5 billion Japanese support for Odisha green ammonia project

A significant boost for India's green energy ambitions! ACME Group's joint venture with Japan's IHI Corporation has secured a massive $5 billion in Japanese government price support. This funding is earmarked for two key clean energy initiatives, including one of India's largest green ammonia projects in Odisha. This development marks a crucial step towards decarbonising vital industrial sectors.

ADANIGREENCLEANCLEANMAXENERGYENERGYDEVGKENERGYINOXGREENIREDAKPELKPIGREENNTPCGREENRPPINFRASAATVIKGLVITALCapital GoodsChemicals
ACME-IHI JV secures $5 billion Japanese support for Odisha green ammonia project
positive
ET Markets - Industry 11d ago

ACME-IHI JV secures $5 billion Japanese support for Odisha green ammonia project

A significant boost for India's green energy ambitions! ACME Group's joint venture with Japan's IHI Corporation has secured a massive $5 billion in Japanese government price support. This funding is earmarked for two key clean energy initiatives, including one of India's largest green ammonia projects in Odisha. This development marks a crucial step towards decarbonising vital industrial sectors.

ADANIGREENCLEANCLEANMAXENERGYENERGYDEVGKENERGYINOXGREENIREDAKPELKPIGREENNTPCGREENRPPINFRASAATVIKGLVITALCapital GoodsChemicals
Oil finds its way: Supertankers return to Persian Gulf
positive
ET Markets - Industry 11d ago

Oil finds its way: Supertankers return to Persian Gulf

Supertankers are once again navigating the Strait of Hormuz, a crucial oil route, following a period of disruption due to recent Iran conflict. Shipping data indicates a significant increase in commodity vessel traffic, including oil tankers, signalling renewed confidence among shipowners. This return of large carriers, with a combined capacity of millions of barrels, is vital for global energy markets as hostilities ease ahead of peace talks.

ENERGYGKENERGYGLOBALGULFOILLUBKPELOILROUTESCIVITALChemicalsConstruction
Anti-dumping duty on electrical steel may push transformer costs, impact grid expansion: GTRI
positive
ET Markets - Industry 15d ago

Anti-dumping duty on electrical steel may push transformer costs, impact grid expansion: GTRI

A potential anti-dumping duty on crucial cold-rolled grain-oriented electrical steel (CRGO) imports could significantly hike transformer manufacturing costs and impede India's ambitious power grid expansion plans. With domestic production meeting less than 10% of demand, imposing duties might raise prices without reducing import reliance, impacting vital infrastructure development and renewable energy integration. The probe follows a complaint by JSW JFE Electrical Steel Nashik Pvt Ltd.

ABHAPOWERDPELENERGYENERGYDEVGKENERGYGVPILIREDAJSWENERGYJSWHLJSWINFRAJSWSTEELKPELMSPLPOWERGRIDQPOWERRELIANCERELINFRARPOWERSALSTEELSERVOTECHSWSOLARVITALCapital GoodsChemicals
India, Iran revive energy dialogue as ministers meet on BRICS sidelines
positive
ET Markets - Industry 16d ago

India, Iran revive energy dialogue as ministers meet on BRICS sidelines

India and Iran are exploring new avenues for energy sector collaboration, as announced by Union Minister Hardeep Singh Puri following a meeting with his Iranian counterpart on the sidelines of the BRICS Energy Ministers’ Meeting. This engagement highlights India's ongoing commitment to bolstering its energy security through strategic partnerships with key producing nations. The discussions aimed at fostering mutually beneficial cooperation in the vital energy domain.

ENERGYGKENERGYKPELVITALChemicalsConstruction
30 India-bound ships cross Strait of Hormuz since Iran war began, 26 more await transit
positive
ET Markets - Industry 16d ago

30 India-bound ships cross Strait of Hormuz since Iran war began, 26 more await transit

Thirty ships bound for India have successfully navigated the Strait of Hormuz, a crucial route disrupted by recent geopolitical tensions. An additional 26 vessels are awaiting passage. Among those that transited, a significant portion carried vital energy supplies like LPG and LNG, alongside bulk cargo and crude oil. This development follows a recent agreement, easing concerns over energy imports for India.

ENERGYENERGYDEVGKENERGYIREDAKPELOILROUTEVITALChemicalsConstruction
Eleven India-bound vessels have crossed Strait of Hormuz since signing of Iran-US MoU: MEA
positive
ET Markets - Industry 18d ago

Eleven India-bound vessels have crossed Strait of Hormuz since signing of Iran-US MoU: MEA

Eleven India-bound vessels have successfully navigated the Strait of Hormuz since the US-Iran agreement on June 17, according to MEA spokesperson Randhir Jaiswal. Ten Indian-flagged ships remain in the Persian Gulf, with two more entering the region. This crucial waterway, vital for global oil transit, has recently faced disruptions, raising concerns about energy supplies and market stability.

ENERGYGKENERGYGLOBALGULFOILLUBIEXIOCIREDAKPELOILVITALChemicalsConstruction
Kudankulam nuclear plant unit-5 gets reactor vessel
positive
ET Markets - Industry 24d ago

Kudankulam nuclear plant unit-5 gets reactor vessel

India's Nuclear Power Corporation has achieved a significant milestone. The reactor pressure vessel for Kudankulam Unit-5 has been installed. This crucial step was completed with support from Russia's Rosatom. The installation marks progress in India's nuclear energy expansion. This project underscores strong India-Russia cooperation in nuclear technology. It is vital for India's energy security goals.

DPELENERGYGKENERGYGVPILKPELVITALCapital GoodsChemicals
India adds 4.6 GWh of energy storage capacity in first quarter of 2026: Report
positive
ET Markets - Industry 25d ago

India adds 4.6 GWh of energy storage capacity in first quarter of 2026: Report

India saw a massive surge in battery energy storage capacity in early 2026. The country added 4.6 gigawatt-hours in the first three months, a 941 percent jump. This rapid expansion positions energy storage as a vital part of India's power infrastructure. Rajasthan leads in cumulative storage capacity. The project pipeline remains robust, indicating continued growth in this sector.

DPELENERGYGKENERGYGVPILKPELVITALCapital GoodsChemicals
Next