Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:CIPLAHealthcare
Clear all filters
Cipla enters biologics joint venture with Kemwell, expands presence in Middle East
neutral
CNBC TV18 - Markets 131d ago

Cipla enters biologics joint venture with Kemwell, expands presence in Middle East

Biologics venture to see initial investment of up to ₹10 crore; Cipla (EU) forms Cipla Middle East Company in Saudi Arabia

BFINVESTCIPLAFinancial ServicesHealthcare
Sensex Today | Stock Market Highlights: Nifty ends below 25,200 after sharp sell-off in last 30 minutes led by banks
negative
CNBC TV18 - Markets 134d ago

Sensex Today | Stock Market Highlights: Nifty ends below 25,200 after sharp sell-off in last 30 minutes led by banks

Sensex Today | Stock Market LIVE Updates: The markets are under immense pressure. The Nifty index is down over 150 points, falling below the 25,300 mark. The Nifty Bank is also down, falling 400 points. The index is now below the 61,000 mark. Maruti Suzuki, Airtel, M&M and Cipla are the biggest losers.

ABSLBANETFALPHAETFAONETMMQ50AONETOTALBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBNKETFAXISCIPLAEBANKNIFTYFINIETFGROWWCAPMGROWWMC150GROWWN200HDFCMID150HDFCNIFBANHDFCPSUBKHDFCPVTBANMARUTIMID150MID150BEESMID150CASEMIDCAPADDMIDCAPBETAMIDCAPETFMIDCAPIETFMIDQ50ADDM&MMOCAPITALMOM30IETFMOMENTUMMOMENTUM30MOMOMENTUMNIFTYQLITYNPBETPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDQUAL30IETFSETFNIFBKAutomobile and Auto ComponentsFinancial Services
Cipla’s Yurpeak gains ground beyond metros as GLP‑1 market accelerates
positive
Moneycontrol NaNd ago

Cipla’s Yurpeak gains ground beyond metros as GLP‑1 market accelerates

Strong uptake is visible across Mumbai, Bengaluru, Delhi, Chennai, Hyderabad, Indore and Pune, as well as smaller but fast‑growing centres such as Cannanore, Vijayawada, Aurangabad, Surat, Faizabad and Mangalore—locations where prescriber activation and distribution density are translating into early conversions.

CIPLAHealthcare
Accumulate Cipla; target of Rs 1400: Prabhudas Lilladher
positive
Moneycontrol NaNd ago

Accumulate Cipla; target of Rs 1400: Prabhudas Lilladher

Prabhudas Lilladher recommended Accumulate rating on Cipla with a target price of Rs 1400 in its research report dated May 14, 2026.

CIPLAHealthcare
Cipla: Strong pipeline to help US business recovery
positive
Moneycontrol NaNd ago

Cipla: Strong pipeline to help US business recovery

Respiratory and peptide pipeline, alongside a recovery in the US business, could drive the next phase of growth

CIPLAHealthcare
Nifty recovers 200 points from intra-day lows; IT continues outperformance | Closing Bell
positive
Moneycontrol NaNd ago

Nifty recovers 200 points from intra-day lows; IT continues outperformance | Closing Bell

Indian equities erased all the intraday losses with Nifty back above 23,500. TCS, Infosys, HCL Tech, Tech Mahindra, Trent are among top gainers on the Nifty, while losers are NTPC, Power Grid Corp, Cipla, Dr Reddy's Labs and L&T. Among sectors IT index up 4%, while auto, metal, Consumer Durables, realty up 0.5% each. However, pharma, healthcare, power, media, energy down 0.5-1%. Nifty Midcap and Smallcap indices down marginally. Catch Lovish Darad in conversation with Market Experts.

ALLETECALPHAALPHAETFAMAGIANKITMETALAONETMMQ50AONETOTALAUTOBEESAUTOIETFBANKIETFCHEMICALCIPLACONSUMERDPELENERGYGKENERGYGROWWLOVOLGROWWMC150GROWWMETALGROWWMOM50GROWWN200GROWWRLTYGROWWSC250GVPILHCGHCG-REHCLTECHHDFCGROWTHHDFCMID150HDFCSML250HEALTHADDHEALTHAXISHEALTHCAREHEALTHIETFHEALTHYHTMEDIAIEXINFYIREDAKPELLICNMID100LIQUID1MASPTOP50METALMETALIETFMID150MID150BEESMID150CASEMIDCAPMIDCAPADDMIDCAPBETAMIDCAPETFMIDCAPIETFMIDQ50ADDM&MMNCMOCAPITALMOENERGYMOM30IETFMOMENTUMMOMENTUM30MOMENTUM50MOMOMENTUMMONIFTY500MOREALTYMOSMALL250MULTICAPNEXT50ETFNIFTY100EWNIFTYQLITYNTPCNTPCGREENPHARMABEESPOWERGRIDPVTBANIETFQUAL30IETFSANOFICONRSBINMID150SDL26BEESSMALL250SMALLADDSMALLCAPSML100CASETCSTECHTECHMTOP10ADDTOP15IETFTOP20TRENTVALUEVIVIANAZTECHAutomobile and Auto ComponentsCapital Goods
Cipla targets $1 billion US run-rate, guides 18.5–20% Ebitda margin for FY27
positive
Moneycontrol NaNd ago

Cipla targets $1 billion US run-rate, guides 18.5–20% Ebitda margin for FY27

“We are expecting that we will be crossing a run rate of $1 billion by the end of FY27,” Managing Director and Global CEO Achin Gupta said in a recent media interaction, underscoring confidence in the company’s pipeline-led recovery.

CIPLAGLOBALHTMEDIAConsumer ServicesHealthcare
Cipla, Sun Pharma, Dr Reddy's, Glenmark trade lower after Centre tightens cough syrup sales rules
negative
Moneycontrol NaNd ago

Cipla, Sun Pharma, Dr Reddy's, Glenmark trade lower after Centre tightens cough syrup sales rules

The broader Nifty Pharma index also traded lower, falling 0.47% to 24,220.10.

ABSLBANETFABSLNN50ETABSLPSEBANKIETFBSLNIFTYCIPLAGLENMARKHEALTHYIVZINNIFTYLICNETFN50MIDCAPBETAMOMENTUMNETFNEXT50BETANIFTYQLITYNPBETPHARMABEESPVTBANIETFSPARCTECHTNIDETFFinancial ServicesHealthcare
Cipla stock up 4% to emerge as top Nifty gainer; Citi sees series of near-term positive US triggers
positive
Moneycontrol NaNd ago

Cipla stock up 4% to emerge as top Nifty gainer; Citi sees series of near-term positive US triggers

The stock was trading at Rs 1,407, up 4.08 percent.

CIPLALTGILTBEESSDL26BEESTOP10ADDTOP15IETFTOP20Financial ServicesHealthcare
Taking Stock: Markets extend losses; Nifty slips below 24,200, Sensex declines 852 pts
neutral
Moneycontrol NaNd ago

Taking Stock: Markets extend losses; Nifty slips below 24,200, Sensex declines 852 pts

Biggest Nifty losers were Trent, M&M, Shriram Finance, SBI Life Insurance, Tech Mahindra, while gainers included Dr Reddy's Labs, Cipla, Jio Financial, Adani Enterprises, Apollo Hospitals.

ABSLBANETFABSLNN50ETABSLPSEADANIENTALPHAALPHAETFAPOLLOAPOLLOHOSPBFSIBSLNIFTYBSLSENETFGCANHLIFECHEMICALCIPLAECAPINSUREGROWWCAPMGROWWN200HDFCLIFEHEALTHYICICIPRULIJIOFINJLHLJMFINANCILLICILIQUID1LIQUIDSBILIQUIDSHRILTFMID150M&MM&MFINMNCMOM30IETFMOMENTUMMOMENTUM30MOMOMENTUMNEXT50ETFNIFTY100EWNIFTYQLITYQUAL30IETFSBILIFESBILIQETFSBIMIDMOMSBINMID150SETFNIF50SETFNIFBKSETFNN50SHRIRAMFINTECHTECHMTRENTZTECHAutomobile and Auto ComponentsCapital Goods
Nifty Pharma jumps nearly 2%; Dr Reddy's, Sun Pharma and Cipla lead gains, dominate Nifty gainers list
positive
Moneycontrol NaNd ago

Nifty Pharma jumps nearly 2%; Dr Reddy's, Sun Pharma and Cipla lead gains, dominate Nifty gainers list

Pharma stocks led the gains on benchmark Nifty 50 and the BSE Midcap index on Tuesday. Dr Reddy's, Sun Pharma and Cipla were the top 3 Nifty gainers, amid news reports that the US FDA has asked Indian firms to help address a shortage of ifosfamide injection.

ABSL10BANKABSLBANETFABSLNN50ETABSLPSEBANK10ADDBANKIETFBSEBSLNIFTYBSLSENETFGCIPLAGILT10BETAGILT5BETAGILT5YBEESGROWWMC150GSEC10IETFGSEC5IETFHDFCMID150HEALTHYLICNMID100MID150MID150BEESMID150CASEMIDCAPMIDCAPADDMIDCAPBETAMIDCAPETFMIDCAPIETFMIDQ50ADDMIDSELIETFMOBANK10MOMENTUMNIFTYQLITYPHARMABEESPVTBANIETFSBINMID150SDL26BEESSPARCTECHTOP10ADDTOP15IETFTOP20Financial ServicesHealthcare