Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:IREDA
Clear all filters
Banks boost renewable energy credit by 7% in April amid energy security concerns
positive
ET Markets - Industry 17d ago

Banks boost renewable energy credit by 7% in April amid energy security concerns

Banks are boosting credit to renewable energy projects, with a 7% jump in April, as global conflicts highlight India's reliance on oil. This surge in funding for green energy underscores the nation's commitment to energy transition. Experts note a growing demand for climate finance, urging banks to develop specialized underwriting for sunrise sectors like solar and green hydrogen, which are poised for significant growth.

ADANIGREENBBETF0432ENERGYGKENERGYGLOBALHDFCGROWTHINOXGREENIREDAKPELKPIGREENLTFMUFINNTPCGREENOILRELIANCERELINFRARHFLRPPINFRASAATVIKGLSOLARINDSSWSOLARCapital GoodsChemicals
NEWS
positive
Business Standard - Markets 17d ago

NLC India inks MoU with Indian Oil Corporation

NLC India has signed a memorandum of understanding (MoU) with Indian Oil Corporation (IOCL) for the formation of a joint venture for the establishment of renewable energy power projects in Tamil Nadu.

DPELENERGYGKENERGYGVPILIEXIOCIREDAKPELNLCINDIAOILPOWERMECHRPPINFRASERVOTECHSWSOLARTNPLCapital GoodsConstruction
FII-powered Suzlon Energy shares sit 15% below 52-week high. Will 2.0 roadmap deliver for 56 lakh investors?
positive
ET Markets - Stocks 17d ago

FII-powered Suzlon Energy shares sit 15% below 52-week high. Will 2.0 roadmap deliver for 56 lakh investors?

Suzlon Energy is attracting steady foreign investment despite market volatility, with FIIs increasing holdings for the third consecutive quarter. The company is transforming into a full-stack renewable energy solutions provider with an ambitious FY31 roadmap, targeting significant revenue growth and market share expansion. Brokerages are optimistic about its "Suzlon 2.0" strategy, focusing on integrated wind, solar, and storage solutions, though a Sebi order remains a concern.

ASMSBFINVESTENERGYGKENERGYIREDAKPELSOLARINDSSUZLONSWSOLARCapital GoodsChemicals
India nears 50% domestic coal use in import-based power plants, sources say
positive
ET Markets - Industry 17d ago

India nears 50% domestic coal use in import-based power plants, sources say

India is significantly boosting the use of domestic coal at power plants previously reliant on imports, aiming to slash costly overseas purchases. Over 50% of capacity at these plants is now running on local fuel, with trials expanding this further. This shift is enabled by increased renewable energy generation freeing up domestic supplies and plant modifications to handle local coal's higher ash content.

COALINDIADPELENERGYGKENERGYGVPILIREDAKPELSERVOTECHSWSOLARCapital GoodsConstruction
NLC India shares in focus after firm signs renewable energy projects MoU with Indian Oil - Upstox
positive
Google News - India Markets 17d ago

NLC India shares in focus after firm signs renewable energy projects MoU with Indian Oil - Upstox

NLC India shares in focus after firm signs renewable energy projects MoU with Indian OilUpstox

ENERGYFOCUSGKENERGYIEXIOCIREDAKPELNLCINDIAOILRPPINFRASWSOLARConstructionConsumer Durables
Hormuz shipping activity shows signs of recovery; Indian refiners shine amid disruption: S&P Global
negative
ET Markets - Industry 18d ago

Hormuz shipping activity shows signs of recovery; Indian refiners shine amid disruption: S&P Global

Shipping through the crucial Strait of Hormuz is showing signs of recovery, with daily transits increasing significantly, though still far below pre-war levels. Indian refiners, however, are demonstrating remarkable resilience, successfully diversifying their crude oil sources to include Russian, Brazilian, West African, and US grades amidst ongoing global energy supply disruptions. Market watchers remain vigilant as geopolitical tensions continue to influence oil trade.

ENERGYGKENERGYGLOBALIEXIOCIREDAKPELOILSCIConstructionConsumer Services
NEWS
positive
Business Standard - Markets 18d ago

NLC India signs MoU with Indian Oil Corporation

For incorporation of a renewable energy JV

ENERGYGKENERGYIEXIOCIREDAKPELNLCINDIAOILSWSOLARConstructionFinancial Services
Nikhil Kamath sees energy transition powering next wave of opportunities
positive
ET Markets - Industry 18d ago

Nikhil Kamath sees energy transition powering next wave of opportunities

Nikhil Kamath, Zerodha co-founder, sees significant investment potential in the energy transition, citing the U.S.-Iran conflict's emphasis on energy security. He's eyeing electric vehicles, battery manufacturing, and grid infrastructure. Kamath also believes Indian IT companies are undervalued, presenting an attractive opportunity. Despite recent market headwinds, he suggests foreign investors often misjudge India's market timing, potentially missing out on current attractive valuations.

BFINVESTCURRENTENERGYGKENERGYIEXIREDAKPELVICTORYEVAutomobile and Auto ComponentsConstruction
NLC India, Indian Oil Corporation partner up for large-scale green energy projects
positive
ET Markets - Industry 18d ago

NLC India, Indian Oil Corporation partner up for large-scale green energy projects

State-run NLC India Limited (NLCIL) has partnered with Indian Oil Corporation Limited (IOC) to form a joint venture focused on developing large-scale green energy projects in Tamil Nadu. This collaboration, formalized by a Memorandum of Understanding, aims to advance renewable energy initiatives including solar, wind, and storage solutions. The partnership signifies a strategic move for NLCIL's diversification into clean energy and contributes to India's sustainable development goals.

ADANIGREENADVANCECLEANCLEANMAXENERGYENERGYDEVGKENERGYIEXINOXGREENIOCIREDAKPELKPIGREENNLCINDIANTPCGREENOILRPPINFRASAATVIKGLSOLARINDSSWSOLARTNPLCapital GoodsChemicals
Eleven India-bound vessels have crossed Strait of Hormuz since signing of Iran-US MoU: MEA
positive
ET Markets - Industry 18d ago

Eleven India-bound vessels have crossed Strait of Hormuz since signing of Iran-US MoU: MEA

Eleven India-bound vessels have successfully navigated the Strait of Hormuz since the US-Iran agreement on June 17, according to MEA spokesperson Randhir Jaiswal. Ten Indian-flagged ships remain in the Persian Gulf, with two more entering the region. This crucial waterway, vital for global oil transit, has recently faced disruptions, raising concerns about energy supplies and market stability.

ENERGYGKENERGYGLOBALGULFOILLUBIEXIOCIREDAKPELOILVITALChemicalsConstruction
Interarch Building Solutions bags ₹165 crore order; June order wins reach ₹375 crore
positive
CNBC TV18 - Markets 18d ago

Interarch Building Solutions bags ₹165 crore order; June order wins reach ₹375 crore

Interarch said it has secured new orders worth approximately ₹375 crore during June 2026, including the ₹165-crore contract from the energy sector in Vadodara, along with projects from the hydrocarbon, farm equipment, electrical products, renewable energy and data centre industries.

ENERGYGKENERGYINDOFARMINTERARCHIREDAKPELRPPINFRASHANKARASWSOLARCapital GoodsConstruction
NEWS
positive
Business Standard - Markets 18d ago

Belding India forms JV with HD Fabcon to foray into renewable energy domain

Belding India said that it has incorporated a subsidiary company namely Belding HD India in joint venture with HD Fabcon, with shareholding structure of 55% and 45%, respectively.

ENERGYGKENERGYIREDAKPELSWSOLARConstructionFinancial Services