Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:FELDVRFinancial Services
Clear all filters
Reliance, Meta announce Jamnagar data centre; CleanMax to supply over 900 MW renewable energy capacity
positive
ET Markets - Industry 31d ago

Reliance, Meta announce Jamnagar data centre; CleanMax to supply over 900 MW renewable energy capacity

Meta Platforms is investing heavily in India's digital future. The company is partnering with Reliance Industries to build a new data center in Gujarat. This facility will support Meta's global AI needs. Additionally, Meta is expanding its renewable energy partnership with CleanMax. This collaboration will add over 900 MW of solar and wind power capacity.

CLEANMAXDPELENERGYFELFELDVRGIPCLGKENERGYGLOBALGVPILIREDAKPELPIGLRELIANCERELINFRARPOWERSERVOTECHSOLARINDSSWSOLARCapital GoodsChemicals
A new-age thirst for beverages is emerging as a key force in India's consumer goods market
positive
ET Markets - Industry 32d ago

A new-age thirst for beverages is emerging as a key force in India's consumer goods market

Beverage industry in India: Indian companies are seeing strong growth in drinks like coffee, ready-to-drink options, and protein beverages. Younger consumers are driving this trend, seeking convenience and health. Companies are expanding their offerings to meet this demand. This shift presents significant opportunities for future expansion in the Indian beverage market.

CONSUMEREVIETFEVINDIAFELFELDVRFMNLGROWWEVMEDANTAVINCOFEConsumer ServicesFinancial Services
Stocks to Buy: This auto parts maker is already up 137% from its IPO price and HSBC sees further upside
positive
CNBC TV18 - Markets 32d ago

Stocks to Buy: This auto parts maker is already up 137% from its IPO price and HSBC sees further upside

Belrise's proposed ₹2,000 crore qualified institutional placement (QIP), if approved, would provide sufficient financial flexibility for future capacity expansion and potential inorganic growth opportunities, HSBC's note said.

BELRISEFELFELDVRJMFINANCILAutomobile and Auto ComponentsConsumer Services
Mid and smallcaps get the money as Nifty lags
positive
ET Markets - Stocks 33d ago

Mid and smallcaps get the money as Nifty lags

Investors are increasingly bullish on mid and small-cap stocks, reflecting a notable shift in market sentiment. The Advance-Decline Ratio has shown resilience for the past two months, leading to record highs in midcap and smallcap indices. Meanwhile, large-cap stocks are grappling with foreign selling pressure, suggesting that mid and small caps may continue to shine in the near future.

ADVANCEAONETMMQ50AONETOTALFELFELDVRFMNLGROWWMC150GROWWSC250HDFCMID150HDFCSML250LICNMID100MID150MID150BEESMID150CASEMIDCAPMIDCAPADDMIDCAPBETAMIDCAPETFMIDCAPIETFMIDQ50ADDMOCAPITALMOSMALL250SBINMID150SMALL250SMALLADDSMALLCAPSML100CASEChemicalsConsumer Services
HC quashes ₹23,600 cr retrospective spectrum dues on Airtel, Voda Idea
neutral
ET Markets - Industry 33d ago

HC quashes ₹23,600 cr retrospective spectrum dues on Airtel, Voda Idea

The Bombay High Court has cancelled spectrum charges of approximately 23,600 crore rupees for Bharti Airtel and Vodafone Idea. The court ruled the government could not retrospectively impose these charges for the period between 2008 and 2012. This decision removes significant financial uncertainty for the telecom sector. It creates a more supportive environment for future investments in India's telecommunications industry.

BHARTIARTLFELFELDVRHPTLIDEAJMFINANCILSPECTRUMCapital GoodsConsumer Services
Indian Companies Pitch Products, Seek Partnerships At Mega Tech Trade Event In Taiwan
positive
NDTV Profit 35d ago

Indian Companies Pitch Products, Seek Partnerships At Mega Tech Trade Event In Taiwan

Organisers said they hoped to see greater participation from Indian companies in future editions of the exhibition as technology cooperation between the two sides continued to expand.

FELFELDVRIWPTECHZTECHConsumer ServicesFinancial Services
IDFC First Bank fraud was isolated case involving collusion: KPMG
negative
ET Markets - Industry 36d ago

IDFC First Bank fraud was isolated case involving collusion: KPMG

A forensic review has confirmed a Rs 646 crore fraud at IDFC First Bank's Chandigarh branch was an isolated incident. The fraud involved collusion between bank employees, government officials, and third parties. The bank has paid back the principal amount and interest. IDFC First Bank has implemented new controls to prevent future collusion risks at the branch level.

BANKINDIAFELFELDVRIDFCFIRSTBConsumer ServicesFinancial Services
'Looks overpriced': Valuation expert Damodaran puts SpaceX worth well below $1.8 trillion
positive
CNBC TV18 - Markets 36d ago

'Looks overpriced': Valuation expert Damodaran puts SpaceX worth well below $1.8 trillion

In a detailed post on X, the New York University professor said the IPO prospectus largely confirmed his earlier assessment of SpaceX as a high-growth but money-losing company whose valuation is driven more by its future narrative than its current financial statements.

CURRENTFELFELDVRJMFINANCILConstructionConsumer Services
Electric mobility key to long-term fight against air pollution: UNEP chief
positive
ET Markets - Industry 36d ago

Electric mobility key to long-term fight against air pollution: UNEP chief

A top UN official stresses electric mobility and mandatory vehicle emissions testing for long-term air pollution solutions. India's plan to phase out older commercial vehicles with cleaner alternatives is highlighted. Investment in clean public transport and cleaner cooking solutions is crucial. Addressing local pollution sources like construction dust and waste burning is also vital for a healthier future.

BFINVESTCLEANFELFELDVRLTGILTBEESOLAELECTCITENNINDVICTORYEVVITALZFCVINDIAAutomobile and Auto ComponentsChemicals
Oil India reports natural gas presence in second Andaman offshore well
positive
ET Markets - Industry 36d ago

Oil India reports natural gas presence in second Andaman offshore well

Oil India Limited has found natural gas in its third exploratory well in the Andaman offshore block. This is the second well in the block to confirm hydrocarbon presence. The discovery is a positive indicator for future exploration in the area. OIL is currently processing seismic data for further appraisal well drilling.

FELFELDVRHINDOILEXPOILOILIETFONGCConsumer ServicesFinancial Services
Sensex rises over 200 points, Nifty above 23,400 as investors eye RBI MPC meet outcome
positive
ET Markets - Stocks 36d ago

Sensex rises over 200 points, Nifty above 23,400 as investors eye RBI MPC meet outcome

Indian stock markets are trading higher today. Sensex and Nifty are extending their gains for a second day. Investors are keenly watching the Reserve Bank of India's Monetary Policy Committee meeting. Market analysts expect the RBI to hold interest rates but signal future hikes. This policy decision will influence banking, auto, and real estate sectors.

ABRELABSLBANETFALPHAETFAONETMMQ50AONETOTALAUTOBEESAUTOIETFBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBNKETFAXISEBANKNIFTYFELFELDVRFINIETFFMNLGROWWCAPMGROWWN200GROWWPSUBKHDFCGROWTHHDFCNIFBANHDFCPSUBKHDFCPVTBANINDIANBIOBMOCAPITALMOM30IETFMOMENTUMMOMENTUM30MOMOMENTUMNIFTYQLITYNPBETPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDQUAL30IETFSETFNIFBKSOUTHBANKTRELConsumer ServicesFinancial Services
ACME Solar raises ₹2,800 crore through QIP; check the list of allottees
positive
CNBC TV18 - Markets 37d ago

ACME Solar raises ₹2,800 crore through QIP; check the list of allottees

The successful completion of the QIP is expected to strengthen Acme Solar's balance sheet by lowering leverage and providing additional financial flexibility to support future growth plans.

ACMESOLARFELFELDVRJMFINANCILSOLARINDSChemicalsConsumer Services