Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:GKENERGYPower
Clear all filters
Inside Samsung's strategy to own every tier of the Smart appliance market
positive
ET Markets - Industry 8d ago

Inside Samsung's strategy to own every tier of the Smart appliance market

Samsung's new Bespoke AI refrigerator range targets India's growing premium appliance market with a three-tiered strategy. From practical Double Door models for everyday households to advanced French Door units acting as kitchen hubs, each segment integrates AI, SmartThings connectivity, and energy intelligence.

ENERGYGKENERGYKPELPREMIUMAutomobile and Auto ComponentsConstruction
Top Gainers & Losers on June 5: Adani Green, Ather Energy, OLA, CarTrade Tech, YES Bank among top gainers
positive
LiveMint - Markets 8d ago

Top Gainers & Losers on June 5: Adani Green, Ather Energy, OLA, CarTrade Tech, YES Bank among top gainers

In terms of weekly performance, the Nifty 50 lost 0.8% of its value, extending its losing streak to a second straight week, while the Sensex also closed lower for the second consecutive week.

ABSLBANETFADANIENSOLADANIENTADANIGREENATHERENERGAXISBNKETFBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBIKEWOCARTRADEEBANKNIFTYENERGYFINIETFGKENERGYGROWWPSUBKHDFCNIFBANHDFCPSUBKHDFCPVTBANINOXGREENKPELKPIGREENMOENERGYNPBETNTPCGREENNV20NV20BEESPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDSAATVIKGLSDL26BEESSETFNIFBKTECHTOP10ADDTOP15IETFTOP20VALUEYESBANKZTECHAutomobile and Auto ComponentsCapital Goods
NEWS
negative
Business Standard - Markets 8d ago

Jagran Prakashan Ltd leads losers in 'B' group

Suven Life Sciences Ltd, Ravindra Energy Ltd, Sunflag Iron & Steel Company Ltd and Exicom Tele-Systems Ltd are among the other losers in the BSE's 'B' group today, 05 June 2026.

ABSL10BANKALIVUSBGRENERGYBSEBSLSENETFGENERGYEXICOMGKENERGYJAGRANJFLLIFEJFL-REKPELRELTDRPGLIFERSYSTEMSSAILIFESALSTEELSUNFLAGSUVENSWELECTESVRAJCapital GoodsConstruction
IFC commits USD 50 million to Hygenco to promote green hydrogen in India
positive
ET Markets - Industry 8d ago

IFC commits USD 50 million to Hygenco to promote green hydrogen in India

International Finance Corporation is investing USD 50 million in Hygenco Green Energies. This funding supports green hydrogen projects across India. The investment aims to scale up competitive green hydrogen supply for industries. Hygenco will develop projects and strengthen supply chains. This initiative will create jobs and support India's energy transition.

ADANIGREENBFINVESTCHOLAFINENERGYGKENERGYINOXGREENJPOLYINVSTKPELKPIGREENLTFMUFINNTPCGREENRPPINFRASAATVIKGLCapital GoodsConstruction
Adani Energy Solutions soars 5%, hits over 3-year high; here's why
positive
Business Standard - Markets 8d ago

Adani Energy Solutions soars 5%, hits over 3-year high; here's why

In the past six months, Adani Energy Solutions stock zoomed 61 per cent as against a 13.3 per cent dip in the BSE Sensex.

ADANIENSOLADANIENTADANIGREENAXSENSEXBSEBSLSENETFGENERGYESENSEXGKENERGYHDFCSENSEXKPELNEXT30ADDSENSEXADDSENSEXBETASENSEXETFSENSEXIETFSNXT30BEESSNXT50BETAConstructionFinancial Services
NEWS
positive
Business Standard - Markets 8d ago

Indraprastha Gas Ltd rises for third straight session

Indraprastha Gas Ltd is quoting at Rs 164.91, up 1.76% on the day as on 12:49 IST on the NSE. The stock is down 21.7% in last one year as compared to a 6.52% jump in NIFTY and a 12.34% jump in the Nifty Energy index.

AONELIQUIDAONENIFTYAONETMMQ50AONETOTALBANKIETFENERGYGKENERGYIGLKPELMOENERGYOILIETFPVTBANIETFConstructionFinancial Services
Jain Irrigation, Ankur Scientific partner on agri waste-to-energy project in Maharashtra
positive
ET Markets - Industry 8d ago

Jain Irrigation, Ankur Scientific partner on agri waste-to-energy project in Maharashtra

Jain Irrigation Systems Ltd and Ankur Scientific are joining forces for a new project in Jalgaon, Maharashtra. This initiative will convert farm waste into thermal energy and biochar. Farmers will gain an extra income source from their crop residue. The plant will process nearly 50 tonnes of agricultural biomass daily.

BGRENERGYENERGYGKENERGYJISLDVREQSJISLJALEQSKPELPOLYSILRSYSTEMSSWELECTESCapital GoodsConstruction
NEWS
positive
Business Standard - Markets 8d ago

Godawari Power & Ispat further invests Rs 100 cr in Godawari New Energy

DPELENERGYGKENERGYGPILGVPILKPELCapital GoodsConstruction
'Kudankulam Nuclear Power Plant now being constructed': Vladimir Putin sees India-Russia trade reaching USD 100 billion
positive
ET Markets - Industry 8d ago

'Kudankulam Nuclear Power Plant now being constructed': Vladimir Putin sees India-Russia trade reaching USD 100 billion

Speaking on the sidelines of the St Petersburg International Economic Forum on Thursday (local time) Putin said Moscow and New Delhi were aiming for more ambitious economic targets as trade between the two nations continues to grow. "We are not only talking about our plans in energy, including nuclear energy. Kudankulam Nuclear Power Plant (KKNPP) is now being constructed," he said.

DPELENERGYGKENERGYGVPILKPELNDTVCapital GoodsConstruction
Maruti Suzuki to invest Rs 925 crore by FY31 towards green energy initiatives
positive
ET Markets - Industry 8d ago

Maruti Suzuki to invest Rs 925 crore by FY31 towards green energy initiatives

Maruti Suzuki India Ltd announced a Rs 925 crore investment by FY 2030-31 for green energy, including two biogas projects. A new 10 TPD biogas plant will be set up at its Kharkhoda facility by FY 2026-27, while the Manesar plant's capacity has been expanded. These initiatives aim to reduce fossil fuel dependence and align with the government's 'Waste-to-Wealth' mission.

ADANIGREENBFINVESTEMMILENERGYGKENERGYINOXGREENKPELKPIGREENMARUTINTPCGREENRPPINFRASAATVIKGLWEALTHAutomobile and Auto ComponentsCapital Goods
Rupee jumps 50 paise as govt scraps capital gains tax on govt bonds for FIIs to attract overseas inflows
positive
LiveMint - Markets 8d ago

Rupee jumps 50 paise as govt scraps capital gains tax on govt bonds for FIIs to attract overseas inflows

The rupee is languishing near record low levels due to higher energy prices and equity market outflows amid the Middle East conflict.

AKCAPITCPCAPENERGYGKENERGYKPELMOCAPITALConstructionFinancial Services
Indian companies willing to deepen presence in Venezuela, says Minister Hardeep Singh Puri
positive
ET Markets - Industry 8d ago

Indian companies willing to deepen presence in Venezuela, says Minister Hardeep Singh Puri

India is looking to deepen its energy partnership with Venezuela, with Indian companies expressing readiness to expand their presence. This move is part of India's strategy to diversify energy sources amid disruptions to global oil supplies caused by the West Asia conflict. Venezuela's vast oil reserves make it a key player in India's efforts to secure stable crude supplies.

ENERGYGKENERGYGLOBALIEXIOCIREDAKPELOILConstructionConsumer Services