Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:RSYSTEMSFinancial Services
Clear all filters
CMS Info Systems wins ₹400 crore order from HDFC Bank for ATM services; Stock may react
positive
CNBC TV18 - Markets 62d ago

CMS Info Systems wins ₹400 crore order from HDFC Bank for ATM services; Stock may react

The order is valued at ₹400 crore across 6,000 ATMs. CMS said as per of the five-year contract, it will manage the service solutions including currency forecast and logistics and its Vision AI solution - HAWKAI.

BANKINDIACMSINFOHDFCBANKHDFCNIFBANHDFCPSUBKHDFCPVTBANMAPMYINDIAPROSTARMRICHARSYSTEMSSERVICESJLOGISTICTVVISIONCapital GoodsFinancial Services
NEWS
positive
Google News - India Markets 62d ago

Stocks to Watch Today: CMS Info Systems, Advanced Enzyme, Niva Bupa, Oberoi Realty, Bank of India, Swiggy,... - Moneycontrol.com

Stocks to Watch Today: CMS Info Systems, Advanced Enzyme, Niva Bupa, Oberoi Realty, Bank of India, Swiggy,...Moneycontrol.com

ADVENZYMESBANKINDIAC2CCMSINFOMAPMYINDIANIVABUPAOBEROIRLTYPROSTARMRICHARSYSTEMSSIGMAADVSWIGGYCapital GoodsConsumer Services
CMS Info Systems bags Rs 400 crore HDFC Bank ATM management mandate
positive
ET Markets - Industry 62d ago

CMS Info Systems bags Rs 400 crore HDFC Bank ATM management mandate

CMS Info Systems has won a significant Rs 400 crore contract with HDFC Bank. The deal spans five years and involves managing 6,000 ATMs. CMS will offer complete ATM services, including cash management and AI-driven optimization. This partnership follows CMS's previous work with ICICI Bank and State Bank of India.

BANKIETFBANKINDIACMSINFOFINIETFHDFCAMCHDFCBANKHDFCNIFBANHDFCPSUBKHDFCPVTBANICICIAMCICICIBANKMAPMYINDIAPROSTARMPSUBNKIETFPVTBANIETFRADIANTCMSRICHARSYSTEMSSBINCapital GoodsFinancial Services
CMS bags Rs 400 cr contract to manage 6,000 HDFC Bank ATMs
positive
ET Markets - Industry 63d ago

CMS bags Rs 400 cr contract to manage 6,000 HDFC Bank ATMs

CMS Info Systems has secured a significant Rs 400 crore order from HDFC Bank. The deal involves managing 6,000 ATMs for the next five years. This partnership will also include advanced solutions like currency forecasting and AI technology. The company expects this to boost its revenue from private sector banks. This follows recent large contracts with ICICI Bank and SBI.

BANKIETFBANKINDIAC2CCMSINFOFINIETFHDFCBANKHDFCNEXT50HDFCNIFBANHDFCPSUBKHDFCPVTBANICICIBANKMAPMYINDIANEXT50IETFPROSTARMPSUBNKIETFPVTBANIETFRICHARSYSTEMSSBIBPBSBIETFPBSETFNIFBKSETFNN50SIGMAADVCapital GoodsFinancial Services
Gujarat builds 870 MW battery power backup network to stabilise renewable energy grid
positive
ET Markets - Industry 63d ago

Gujarat builds 870 MW battery power backup network to stabilise renewable energy grid

Gujarat has launched battery storage systems totaling 870 MW across five locations to ensure renewable power grid stability. The state has also registered 13 additional projects and integrated BESS with its first solar village, Modhera. This initiative strengthens Gujarat's position as a leader in battery storage solutions in India.

BGRENERGYDPELENERGYGIPCLGKENERGYGSFCGSPLGVPILIREDAKPELPIGLPOWERGRIDPOWERMECHRPPINFRARSYSTEMSSERVOTECHSMARTENSOLARINDSSWELECTESSWSOLARTDPOWERSYSUTLSOLARCapital GoodsChemicals
India's mining sector can create 25 million jobs by 2047: Report
positive
ET Markets - Industry 64d ago

India's mining sector can create 25 million jobs by 2047: Report

India's mining sector is poised for significant growth. A new report suggests "Mining 5.0" can boost the economy by USD 500 billion and create 25 million jobs by 2047. This transformation relies on artificial intelligence, integrated digital systems, and sustainable practices. The industry is shifting towards value-driven, technology-enabled operations.

RSYSTEMSVALUEFinancial ServicesInformation Technology
DRC Systems India Limited Schedules Board Meeting on May 18, 2026 to Approve FY26 Audited Financial Results - scanx.trade
negative
Google News - India Markets 64d ago

DRC Systems India Limited Schedules Board Meeting on May 18, 2026 to Approve FY26 Audited Financial Results - scanx.trade

DRC Systems India Limited Schedules Board Meeting on May 18, 2026 to Approve FY26 Audited Financial Resultsscanx.trade

DRCSYSTEMSJMFINANCILRSYSTEMSFinancial ServicesInformation Technology
NEWS
positive
Business Standard - Markets 65d ago

Maral Overseas Ltd leads gainers in 'B' group

Anuroop Packaging Ltd, Cybertech Systems & Software Ltd, We Win Ltd and Sandur Manganese & Iron Ores Ltd are among the other gainers in the BSE's 'B' group today, 08 May 2026.

BSECYBERTECHMARALOVERRSSOFTWARERSYSTEMSSANDUMAWEWINFinancial ServicesInformation Technology
Multibagger defence stock Apollo Micro Systems jumps 7% after this order book update - Mint
positive
Google News - India Markets 65d ago

Multibagger defence stock Apollo Micro Systems jumps 7% after this order book update - Mint

Multibagger defence stock Apollo Micro Systems jumps 7% after this order book updateMint

APOLLODEFENCERSYSTEMSCapital GoodsFinancial Services
UAE Issues Red Alert For Missile Threat —'Stay In Safe Place'
negative
NDTV Profit 65d ago

UAE Issues Red Alert For Missile Threat —'Stay In Safe Place'

As per reports, since the start of Iranian attacks on the UAE, air defence systems have intercepted 549 ballistic missiles.

DEFENCERSYSTEMSFinancial ServicesInformation Technology
Railways plans AI cameras; new orders on hold
neutral
ET Markets - Industry 65d ago

Railways plans AI cameras; new orders on hold

Research Designs and Standards Organisation first specified internet protocol-based video surveillance systems for rolling stock in March 2018. The norms have since been amended seven times, most recently in June 2025. The current specifications define parameters for closed-circuit television cameras that record activities inside and outside trains for post-event analysis.

CURRENTINTERNETNDTVRSYSTEMSConstructionFinancial Services
Yanolja acquires InnKey to expand global enterprise hospitality platform
positive
ET Markets - Industry 66d ago

Yanolja acquires InnKey to expand global enterprise hospitality platform

Global travel technology firm Yanolja has acquired India's InnKey, an enterprise hospitality platform. This move strengthens Yanolja's global reach in the hotel sector. InnKey's unified system manages hotel operations, including front office and finance. The acquisition aims to enhance guest experiences and streamline operations for hotel groups. InnKey's platform supports over 500 hotels in India and integrates with global systems.

GLOBALLTFRSYSTEMSConsumer ServicesFinancial Services