Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:FEL
Clear all filters
Zee Entertainment plans to raise at least ₹2,300 crore for future growth
positive
CNBC TV18 - Markets 31d ago

Zee Entertainment plans to raise at least ₹2,300 crore for future growth

ZEEL board approves plan to raise at least 2300 crore in phases to fund strategic and business initiatives, including expansion after securing FIFA broadcasting rights

AONELIQUIDBBETF0432FELFELDVRHDFCGROWTHLIQGRWBEESLIQUIDPLUSMOGSECSBILIQETFZEELConsumer ServicesFinancial Services
NEWS
negative
Business Standard - Markets 31d ago

INR pares initial losses and settles largely unchanged

The Indian rupee was largely flat and settled almost unchanged at Rs 95.43 per dollar, down just 2 paise on Wednesday, amid likely intervention from the Reserve Bank of India (RBI) to curb excessive volatility and prevent a further slide in the domestic unit. Rupee pared its initial losses as crude oil prices and the US dollar index retreated from their elevated levels. Indian shares gave up early gains to end little changed on Wednesday as investors weighed rising U.S.-Iran tensions and awaited key U.S. inflation data later in the day for fresh insights into market expectations for future interest rates in the face of rising energy-driven inflation risks. The BSE Sensex ended the day at 73,983.18, up by 64.42 points (0.09%), while the NSE Nifty 50 settled at 23,214.95, slipping by 27.15 points (-0.12%).

ABSLBANETFALPL30IETFAONETMMQ50AONETOTALBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBNKETFAXISBSEBSLSENETFGDOLLAREBANKNIFTYENERGYESENSEXFELFELDVRFINIETFFMNLGKENERGYGROWWLOVOLGROWWPSUBKHDFCNIFBANHDFCPSUBKHDFCPVTBANHDFCSENSEXIEXINDIANBIOBIOCIREDAKPELLOWVOLLOWVOL1LOWVOLIETFMOCAPITALMOENERGYMOLOWVOLNEXT30ADDNPBETOILOILIETFPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDSBIBPBSENSEXADDSENSEXAXISSENSEXBETASENSEXETFSENSEXIETFSETFNIFBKSNXT30BEESSNXT50BETASOUTHBANKConstructionConsumer Services
Air India denies pressuring AI-171 victims' families to sign compensation waiver, says no deadline to accept settlement
negative
ET Markets - Industry 31d ago

Air India denies pressuring AI-171 victims' families to sign compensation waiver, says no deadline to accept settlement

Air India refutes claims of pressuring families of AI-171 crash victims. The airline states there is no deadline or pressure to accept its final settlement offer. Relatives are free to wait for official investigation findings before deciding on compensation. The RDI document aims to finalize settlements and protect Air India from future claims.

FELFELDVRConsumer Services
CNG momentum to stay robust through FY27, Morbi PNG demand set for all-time high
positive
ET Markets - Industry 31d ago

CNG momentum to stay robust through FY27, Morbi PNG demand set for all-time high

CNG vehicle registrations and industrial gas utilization are poised for remarkable growth. With CNG vehicles presenting significant cost benefits over electric and petrol options, the future looks bright. Gujarat Gas is gearing up for heightened LNG blending to satisfy the soaring demand in Morbi, where industries favor PNG(I) for dependable supply.

ALLETECALLTIMEFELFELDVRGUJENERGYMOMENTUMVICTORYEVAutomobile and Auto ComponentsConsumer Durables
Reliance, Meta announce Jamnagar data centre; CleanMax to supply over 900 MW renewable energy capacity
positive
ET Markets - Industry 32d ago

Reliance, Meta announce Jamnagar data centre; CleanMax to supply over 900 MW renewable energy capacity

Meta Platforms is investing heavily in India's digital future. The company is partnering with Reliance Industries to build a new data center in Gujarat. This facility will support Meta's global AI needs. Additionally, Meta is expanding its renewable energy partnership with CleanMax. This collaboration will add over 900 MW of solar and wind power capacity.

CLEANMAXDPELENERGYFELFELDVRGIPCLGKENERGYGLOBALGVPILIREDAKPELPIGLRELIANCERELINFRARPOWERSERVOTECHSOLARINDSSWSOLARCapital GoodsChemicals
Air India Express defers Noida Airport launch, exits Hindon amid cost-cutting
positive
ET Markets - Industry 32d ago

Air India Express defers Noida Airport launch, exits Hindon amid cost-cutting

Air India Express has indefinitely postponed its operations from Noida International Airport. This reduces the number of airlines launching services at the new airport next week. IndiGo will start services on opening day, followed by Akasa Air. Air India Group is focusing on cost reduction. Hindon Airport traffic has declined significantly. Stakeholders remain optimistic about future growth.

FELFELDVRINDIGOConsumer ServicesServices
Sebi eyes market making framework for commodity derivatives to improve liquidity
positive
LiveMint - Markets 32d ago

Sebi eyes market making framework for commodity derivatives to improve liquidity

Sebi is considering a market-making framework to boost liquidity in longer-dated commodity derivatives, helping businesses hedge future price risks more effectively. The move aims to reduce dependence on near-expiry contracts, improve price discovery and deepen India's commodity markets.

FELFELDVRFMNLConsumer ServicesServices
This Small-Cap Meta, Uber, Coinbase Supplier Has A Rs 2,964-Crore Order Book. What Comes Next?
positive
NDTV Profit 32d ago

This Small-Cap Meta, Uber, Coinbase Supplier Has A Rs 2,964-Crore Order Book. What Comes Next?

Recurring revenue and AI-led infrastructure spending are lifting growth, but the key question is whether future gains are already reflected in valuations.

FELFELDVRConsumer Services
'Deal Pipeline Stronger Than Ever': TCS Chairman Highlights Five Areas Powering Future Growth
positive
NDTV Profit 32d ago

'Deal Pipeline Stronger Than Ever': TCS Chairman Highlights Five Areas Powering Future Growth

TCS framed AI as the "most significant opportunity" in the history of the company.

FELFELDVRTCSConsumer ServicesInformation Technology
A new-age thirst for beverages is emerging as a key force in India's consumer goods market
positive
ET Markets - Industry 33d ago

A new-age thirst for beverages is emerging as a key force in India's consumer goods market

Beverage industry in India: Indian companies are seeing strong growth in drinks like coffee, ready-to-drink options, and protein beverages. Younger consumers are driving this trend, seeking convenience and health. Companies are expanding their offerings to meet this demand. This shift presents significant opportunities for future expansion in the Indian beverage market.

CONSUMEREVIETFEVINDIAFELFELDVRFMNLGROWWEVMEDANTAVINCOFEConsumer ServicesFinancial Services
Stocks to Buy: This auto parts maker is already up 137% from its IPO price and HSBC sees further upside
positive
CNBC TV18 - Markets 33d ago

Stocks to Buy: This auto parts maker is already up 137% from its IPO price and HSBC sees further upside

Belrise's proposed ₹2,000 crore qualified institutional placement (QIP), if approved, would provide sufficient financial flexibility for future capacity expansion and potential inorganic growth opportunities, HSBC's note said.

BELRISEFELFELDVRJMFINANCILAutomobile and Auto ComponentsConsumer Services
Hotel giants bet India’s local travel boom can defy slowdown
positive
ET Markets - Industry 33d ago

Hotel giants bet India’s local travel boom can defy slowdown

Major hotel groups are investing heavily in India. They expect a surge in domestic travel to drive growth. This expansion continues despite economic concerns. Prime Minister Modi encourages local holidays. India's tourism market is set for significant expansion. New hotels are planned across the country. This signals a bright future for Indian hospitality.

CCHHLFELFELDVRFMNLINDHOTELIRCTCConsumer ServicesServices