Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:DEFENCEConstruction
Clear all filters
RB Infrastructure Trust to transfer two BOT Highway assets with enterprise value of Rs 4,605 crore
positive
ET Markets - Industry 9d ago

RB Infrastructure Trust to transfer two BOT Highway assets with enterprise value of Rs 4,605 crore

IRB Infrastructure Developers announced a significant deal where its sponsored platforms will transfer two BOT highway assets, Solapur Yedeshi and Chittorgarh Gulabpura, to IRB InvIT Fund for Rs 4,605 crore. This strategic move reinforces IRB's position as a leading sponsor and O&M platform, propelling its ambition to build a substantial asset base in the coming years.

ALPHAETFBANKETFBANKPSUBFSIDEFENCEDIVIDENDENERGYEQUAL200EQUAL50ESGGOLDETFGSEC10YEARHDFCVALUEHEALTHCAREHILINFRAINTERNETIRBITETFLIQUIDLIQUIDPLUSLOWVOLMAFANGMAHKTECHMAKEINDIAMASPTOP50METALMIDCAPETFMOVALUEMULTICAPNEXT50NIFTYETFSELECTIPOSENSEXETFSILVERAGSMALL250TOP20TRUSTVAL30IETFVALUEVALUEAXISConstructionFinancial Services
Japan To Deepen Strategic Co-Operation With India; Takaichi Says Ties Important To Address Issues
positive
NDTV Profit 9d ago

Japan To Deepen Strategic Co-Operation With India; Takaichi Says Ties Important To Address Issues

The two sides also unveiled a joint roadmap on economic security covering energy, semiconductors and resilient supply chains, while agreeing to co-develop defence technologies and issue a joint statement on artificial intelligence.

DEFENCEENERGYGKENERGYKPELConstructionFinancial Services
Buy, Sell Or Hold: IDFC First Bank, JSW Energy, Wockhardt, Paras Defence And Titagarh Rail — Ask Profit
positive
NDTV Profit 11d ago

Buy, Sell Or Hold: IDFC First Bank, JSW Energy, Wockhardt, Paras Defence And Titagarh Rail — Ask Profit

Market experts shared buy, sell and hold recommendations for an array of stocks.

BANKINDIADEFENCEENERGYGKENERGYIDFCFIRSTBJSWENERGYJSWHLJSWINFRAKPELPARASTITAGARHWOCKPHARMACapital GoodsConstruction
Healthcare, banks and EVs remain long-term bets: Invesco Mutual Fund's Taher Badshah
positive
CNBC TV18 - Markets 11d ago

Healthcare, banks and EVs remain long-term bets: Invesco Mutual Fund's Taher Badshah

Taher Badshah, Chief Investment Officer at Invesco Mutual Fund, expects EV adoption to increase gradually with policy support, while opportunities are emerging in power distribution alongside transmission. Badshah also said SIP inflows remain stable and mutual fund industry trends are not showing signs of concern.

ABSLPSEALPHAALPHAETFAONEGOLDAONELIQUIDAONENIFTYAONESILVERAONETOTALAUTOBEESAUTOIETFAXISBPSETFBANK10ADDBANKADDBANKBETFBANKETFBANKPSUBBETF0432BBNPNBETFBBNPPGOLDBFINVESTBFSIBNKETFAXISCHEMICALCHOICEGOLDCOMMOIETFCONSUMAXISDEFENCEDIVIDENDEBANKNIFTYEBBETF0430EBBETF0431EBBETF0433ECAPINSUREEGOLDELIQUIDELM250ENERGYENIFTYEQUAL200EQUAL50EQUAL50ADDESENSEXESGESILVERFINIETFFLEXIADDFMCGADDFMCGIETFGILT10BETAGILT5BETAGOLD1GOLD360GOLDADDGOLDAXISGOLDBETAGOLDBNDGOLDETFGROWWCAPMGROWWCHEMGROWWDEFNCGROWWEVGROWWGOLDGROWWHOSPIGROWWLIQIDGROWWLOVOLGROWWMC150GROWWMETALGROWWMOM50GROWWN200GROWWNETGROWWNIFTYGROWWNXT50GROWWPOWERGROWWPSEGROWWPSUBKGROWWRAILGROWWRLTYGROWWSC250GROWWSLVRGSEC10IETFGSEC10YEARGVPILHCGHCG-REHDFCGOLDHDFCGROWTHHDFCLOWVOLHDFCMID150HDFCMOMENTHDFCNEXT50HDFCNIF100HDFCNIFITHDFCPSUBKHDFCPVTBANHDFCQUALHDFCSILVERHDFCSML250HDFCVALUEHEALTHADDHEALTHAXISHEALTHCAREHEALTHIETFHSBCGOLDICICIB22INFRAIETFINTERNETITADDITAXISITBEESITBETAITETFITIETFIVZINGOLDIVZINNIFTYLICNETFSENLICNMID100LIQGRWBEESLIQUIDLIQUID1LIQUIDPLUSLIQUIDSBILIQUIDSHRILOWVOLLTGILTBEESMAFANGMAHKTECHMAKEINDIAMANUFGBEESMASPTOP50METALMETALIETFMID150MIDCAPADDMIDCAPBETAMIDCAPETFMIDCAPIETFMIDQ50ADDMNCMOALPHA50MOBANK10MOCAPITALMODEFENCEMOENERGYMOGOLDMOGSECMOHEALTHMOINFRAMOIPOMOLOWVOLMOM100MOM30IETFMOM50MOMENTUMMOMENTUM30MOMENTUM50MOMGFMOMIDMTMMOMNCMOMOMENTUMMON100MON50EQUALMONEXT50MONIFTY100MONIFTY500MONQ50MOPSEMOQUALITYMOREALTYMOSERVICEMOSILVERMOSMALL250MOTOURMOVALUEMSCIADDMSCIINDIAMULTICAPNEXT30ADDNEXT50NEXT50ADDNEXT50BETANEXT50ETFNEXT50IETFNIFTY100EWNIFTYADDNIFTYAXISNIFTYBETFNIFTYETFNIFTYQLITYOILIETFOMPOWERPHARMABEESPSUBANKADDPSUBNKIETFPVTBANKADDQUALITY30SBIBPBSBIETFCONSBIETFITSBIETFPBSBIETFQLTYSBILIQETFSBINEQWETFSBINMID150SBISILVERSELECTIPOSENSEXAXISSENSEXETFSETF10GILTSILVERSILVER1SILVER360SILVERADDSILVERAGSILVERAXISSILVERBEESSILVERBETASILVERBNDSILVERIETFSMALL250SMALLADDSNXT30BEESTATAGOLDTATSILVTECHTNIDETFTOP10ADDTOP20TWCGOLDETFUNIONGOLDVAL30IETFVALUEVALUEAXISCapital GoodsConstruction
DFP-2026 Released: Rajnath Singh Empowers DRDO For Faster Execution Of Defence R&D Projects
positive
NDTV Profit 12d ago

DFP-2026 Released: Rajnath Singh Empowers DRDO For Faster Execution Of Defence R&D Projects

The DFPDS-2026 goal is to improve operational efficiency by facilitating faster decision-making.

DEFENCERPPINFRAConstructionFinancial Services
Amber Group eyes $2 billion revenue milestone soon; invests Rs 6,750 crore in UP projects
positive
ET Markets - Industry 14d ago

Amber Group eyes $2 billion revenue milestone soon; invests Rs 6,750 crore in UP projects

Amber Group is poised to reach USD 2 billion in revenue soon, fueled by robust growth in its consumer durables, electronics, and railway/defence sectors. The company recently broke ground on a significant Rs 6,785 crore manufacturing expansion in Jewar, Uttar Pradesh. This includes a crucial PCB and semiconductor substrate unit via a joint venture, alongside an expanded air-conditioner complex, aiming for import substitution and future exports.

AMBERCONSUMERDEFENCEFELFELDVRHDFCGROWTHLGEINDIARPPINFRAConstructionConsumer Durables
Adani Group to enter nuclear power, targets 10 GW by 2035
positive
ET Markets - Industry 17d ago

Adani Group to enter nuclear power, targets 10 GW by 2035

Gautam Adani revealed ambitious expansion plans, including a 10 GW nuclear power venture by 2035 under Adani Atomic Energy. The conglomerate also boosted its thermal power target to 45 GW by FY32 and data centre capacity to 3 GW by 2030. These moves signal a significant push into energy, AI-driven computing, and defence, alongside new partnerships in aircraft manufacturing and hydropower.

ADANIENSOLADANIENTADANIGREENADANIPOWERDEFENCEDPELENERGYGKENERGYGVPILKPELCapital GoodsConstruction
Adani Group AGM 2026: Top 10 highlights from Gautam Adani's address
positive
CNBC TV18 - Markets 17d ago

Adani Group AGM 2026: Top 10 highlights from Gautam Adani's address

Gautam Adani used the group's AGM to lay out an expansive vision spanning AI, nuclear energy, data centres, airports, power and defence, while highlighting record investments, strong financial performance and long-term infrastructure ambitions.

ADANIENSOLADANIENTADANIGREENADANIPOWERDEFENCEDPELENERGYGKENERGYGVPILJMFINANCILKPELLTGILTBEESSDL26BEESTVVISIONCapital GoodsConstruction
Nisus Finance to raise up to Rs 4,000 crore through a real assets investment platform
positive
ET Markets - Industry 17d ago

Nisus Finance to raise up to Rs 4,000 crore through a real assets investment platform

Nisus Finance is launching a real assets platform to raise up to Rs 4,000 crore, targeting yield-generating and value-accretive real estate opportunities across India. The platform will attract domestic and UAE-based investors, including family offices and ultra-high-net-worth individuals. A key vehicle, the Nisus Yield and Asset Multiplier Fund (NiYAM), will focus on structured credit and equity enhancement for projects like plotted developments and redevelopment.

ABRELALPHAETFAPTUSBANKETFBANKPSUBFINVESTBFSICHOLAFINDEFENCEDIVIDENDENERGYEQUAL200EQUAL50ESGFOCUSGOLDETFGSEC10YEARHDFCVALUEHEALTHCAREINTERNETITETFJPOLYINVSTLIQUIDLIQUIDPLUSLOWVOLLTFMAFANGMAHKTECHMAKEINDIAMASPTOP50METALMIDCAPETFMOVALUEMULTICAPNEXT50NIFTYETFRPPINFRASELECTIPOSENSEXETFSILVERAGSMALL250TOP20TRELVAL30IETFVALUEVALUEAXISConstructionConsumer Durables
NEWS
positive
Business Standard - Markets 18d ago

Diffusion Engineers rises after bagging Rs 7-cr defence industry order

Diffusion Engineers rose 2.09% to Rs 384.30 after the company announced that it has secured a domestic order worth approximately Rs 7.49 crore for the supply of flux-cored wire to the defence industry.

DEFENCEDIFFNKGENGINERSINCapital GoodsConstruction
Garden Reach shares rise 5% on Navratna status; here's what analysts say
positive
Business Standard - Markets 19d ago

Garden Reach shares rise 5% on Navratna status; here's what analysts say

Garden Reach Shipbuilders & Engineers is a defence public sector undertaking, under the administrative control of Ministry of Defence.

DEFENCEENGINERSINGRSECapital GoodsConstruction
NEWS
positive
Business Standard - Markets 19d ago

Cranex receives orders worth Rs 18.52 cr

The fresh orders received by the Company include orders from BHEL and Indian Railways for workshop infrastructure projects. In addition, the Company's existing order book includes orders from BEML for railway projects including the Vande Bharat programme and orders for defence sector projects across India.

BEMLBHELDEFENCEIRCTCIRFCRPPINFRACapital GoodsConstruction