Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:FELConstruction
Clear all filters
Cabinet approves two highway projects for Rs 14,115 crore
positive
ET Markets - Industry 9d ago

Cabinet approves two highway projects for Rs 14,115 crore

The government has greenlit two major highway projects totaling Rs 14,115 crore. A 117.7 km access-controlled highway in Uttar Pradesh, designed for future expansion, will slash travel time between Kanpur and Kabrai by 58%. Additionally, an 8.1 km six-lane road tunnel in Delhi will significantly improve connectivity between West and South Delhi, minimizing disruption to the Southern Ridge Forest. These initiatives aim to boost infrastructure and facilitate efficient traffic flow.

FELFELDVRHILINFRARPPINFRASOUTHWESTConstructionConsumer Services
Delhi EV Policy 2026 paves way for hydrogen-powered vehicles
positive
ET Markets - Industry 10d ago

Delhi EV Policy 2026 paves way for hydrogen-powered vehicles

Delhi's new Electric Vehicle Policy 2026 paves the way for hydrogen fuel-based vehicles within four years, aiming to curb vehicular emissions, a major contributor to air pollution. The city plans to introduce two hydrogen-powered buses soon, with the Delhi Transport Corporation collaborating with NTPC for this initiative. This move signifies a significant stride towards cleaner, sustainable public transportation and a future-ready mobility ecosystem for the national capital.

AKCAPITCPCAPE2ERAILFELFELDVRNDTVNTPCOLAELECTCIVICTORYEVAutomobile and Auto ComponentsConstruction
Technology to be central to Hindustan Zinc's next phase of growth: Chairperson
positive
ET Markets - Industry 12d ago

Technology to be central to Hindustan Zinc's next phase of growth: Chairperson

Hindustan Zinc is pivoting towards becoming a future-ready energy transition company, Chairperson Priya Agarwal Hebbar announced. The firm is significantly investing in technology like AI and automation to boost productivity and safety. Diversifying beyond zinc, the company is exploring critical minerals such as lithium and rare earth elements, essential for the growing electric vehicle market and India's industrial expansion. This strategic shift, dubbed Hindustan Zinc 2.

AGARINDENERGYFELFELDVRFMNLGKENERGYHINDZINCKPELNRAILSARDAENChemicalsConstruction
Amber Group eyes $2 billion revenue milestone soon; invests Rs 6,750 crore in UP projects
positive
ET Markets - Industry 13d ago

Amber Group eyes $2 billion revenue milestone soon; invests Rs 6,750 crore in UP projects

Amber Group is poised to reach USD 2 billion in revenue soon, fueled by robust growth in its consumer durables, electronics, and railway/defence sectors. The company recently broke ground on a significant Rs 6,785 crore manufacturing expansion in Jewar, Uttar Pradesh. This includes a crucial PCB and semiconductor substrate unit via a joint venture, alongside an expanded air-conditioner complex, aiming for import substitution and future exports.

AMBERCONSUMERDEFENCEFELFELDVRHDFCGROWTHLGEINDIARPPINFRAConstructionConsumer Durables
Transrail Lighting Ltd secures overseas orders worth Rs 459 cr
positive
ET Markets - Industry 15d ago

Transrail Lighting Ltd secures overseas orders worth Rs 459 cr

Transrail Lighting Ltd has secured significant international orders totaling approximately Rs 459 crore, primarily for transmission line construction in the Middle East and North Africa. This boosts the company's total order inflow for the year to Rs 1,034 crore. Additionally, Transrail is the Lowest (L1) bidder for projects worth around Rs 400 crore, indicating a strong future pipeline and sustained growth prospects.

FELFELDVRGENCONMOGSECRPPINFRATOTALTRANSRAILLCapital GoodsConstruction
Jupiter International Ltd invests Rs 550 cr in new TOPCon solar cell facility in Himachal's Baddi
positive
ET Markets - Industry 16d ago

Jupiter International Ltd invests Rs 550 cr in new TOPCon solar cell facility in Himachal's Baddi

Jupiter International Ltd has boosted its solar cell manufacturing capacity to 3.25 GW with a new 1.25 GW TOPCon unit in Himachal Pradesh, investing Rs 550 crore. This move signifies a shift towards advanced, high-efficiency solar technologies. The company's CEO highlighted this as a key step in their technology journey, paving the way for future expansions and supporting India's clean energy goals.

CLEANCLEANMAXENERGYFELFELDVRGKENERGYKPELSOLARINDSChemicalsConstruction
Forget power: The unquenchable AI thirst propelling water stocks up to 45%
positive
ET Markets - Stocks 16d ago

Forget power: The unquenchable AI thirst propelling water stocks up to 45%

India's water sector is experiencing a surge, with stocks like Shakti Pumps and VA Tech Wabag jumping up to 45% in a month. This rally is fueled by increased government funding for water infrastructure and the growing demand from data centers for cooling. Experts predict wastewater treatment and recycling will be key growth areas, though current valuations reflect future optimism more than present earnings.

CURRENTFELFELDVRGVPILSHAKTIPUMPTECHVIVIANAWABAGZTECHCapital GoodsConstruction
India needs to diversify its sources of energy needs, says NITI vice-chairman
positive
ET Markets - Industry 18d ago

India needs to diversify its sources of energy needs, says NITI vice-chairman

NITI Aayog Vice Chairman Ashok Kumar Lahiri highlighted that the West Asia conflict, though a temporary supply chain issue, underscores India's need to diversify energy sources. He expressed optimism about an upcoming India-US trade agreement and advocated for including pharmaceutical products in future FTAs. Lahiri likened the crisis to a manageable 'influenza,' emphasizing the lesson of not concentrating all import and export dependencies.

ALLETECBMETRICSENERGYFELFELDVRGKENERGYKPELSKMEGGPRODTVSSCSConstructionConsumer Services
VinFast India partners Shriram Finance for vehicle finance
positive
ET Markets - Industry 18d ago

VinFast India partners Shriram Finance for vehicle finance

VinFast India has joined hands with Shriram Finance Ltd to boost electric vehicle adoption through accessible retail finance. This collaboration offers customers up to 100% on-road funding, competitive interest rates, and flexible repayment plans. Leveraging Shriram Finance's wide network, the partnership aims to simplify EV ownership and accelerate its uptake across India, supporting a greener mobility future.

BRNLFELFELDVRLTFOLAELECRETAILSDREAMSSHRIRAMFINV2RETAILAutomobile and Auto ComponentsConstruction
Iran war triggers global race to build oil reserves
negative
ET Markets - Industry 19d ago

Iran war triggers global race to build oil reserves

Vulnerable nations, stung by the Iran war's economic fallout, are boosting oil and gas storage to weather future crises. This global push for reserves could add half a billion barrels of demand. Countries like India and Pakistan are prioritizing stockpiles, learning from China's successful strategy of reducing imports during supply disruptions. This move aims to prevent severe economic distress and insulate economies from volatile energy markets.

ENERGYFELFELDVRGKENERGYGLOBALKPELOILOILIETFONGCRACEVOGLConstructionConsumer Services
ONGC rebrands itself as ‘gas and oil’ firm as natural gas output overtakes crude
positive
ET Markets - Industry 20d ago

ONGC rebrands itself as ‘gas and oil’ firm as natural gas output overtakes crude

State-run ONGC is shifting its focus, now prioritizing natural gas over crude oil. Chairman Arun Kumar Singh announced that gas production has surpassed oil, with future growth expected to be driven by expanding gas output. Policy reforms and rising domestic demand are supporting this strategic pivot, as ONGC invests heavily in offshore projects and explores clean energy avenues.

CLEANCLEANMAXENERGYFELFELDVRFOCUSGKENERGYKPELOILOILIETFONGCRPPINFRAVOGLChemicalsConstruction
BHAVINI hosts industry partnership conclave to drive country's fast breeder reactor expansion
positive
ET Markets - Industry 21d ago

BHAVINI hosts industry partnership conclave to drive country's fast breeder reactor expansion

BHAVINI, a Department of Atomic Energy firm, hosted a crucial partnership conclave for fast breeder reactor expansion. Senior industry leaders, technology partners, and engineering organizations convened to chart a collaborative roadmap for India's nuclear energy future. This initiative underscores a commitment to clean, sustainable nuclear power, aligning with national climate goals and the objective of achieving net-zero emissions by 2070.

CLEANCLEANMAXDPELENERGYFELFELDVRGKENERGYGVPILHGINFRAKPELMBELCapital GoodsChemicals