Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:DEFENCEConsumer Services
Clear all filters
HAL offers the best risk-reward among defence stocks despite expensive valuations, says Equirus
positive
CNBC TV18 - Markets 4d ago

HAL offers the best risk-reward among defence stocks despite expensive valuations, says Equirus

Harshit Patel, Director of Equirus Securities expects Bharat Dynamics to be a key beneficiary of the Defence Acquisition Council's ₹52,000-crore approvals, while BEL, Data Patterns, Apollo Micro Systems and Astra Microwave are well placed to benefit from rising demand for defence electronics and anti-drone systems.

APOLLOASTRAMICROBDLBELDATAPATTNSDEFENCEDRONEHALLGEINDIARSYSTEMSCapital GoodsConsumer Durables
NIFTY50 above 24,400, SENSEX up 557 pts in noon deals; defence stocks, Nykaa, Aegis Vopak Terminals among buzzing stocks - Upstox
positive
Google News - India Markets 5d ago

NIFTY50 above 24,400, SENSEX up 557 pts in noon deals; defence stocks, Nykaa, Aegis Vopak Terminals among buzzing stocks - Upstox

NIFTY50 above 24,400, SENSEX up 557 pts in noon deals; defence stocks, Nykaa, Aegis Vopak Terminals among buzzing stocksUpstox

AEGISVOPAKDEFENCENYKAAConsumer ServicesFinancial Services
NEWS
neutral
Business Standard - Markets 5d ago

TD Power Systems Ltd leads gainers in 'A' group

Paras Defence and Space Technologies Ltd, Welspun Corp Ltd, Allied Blenders & Distillers Ltd and Lloyds Engineering Works Ltd are among the other gainers in the BSE's 'A' group today, 06 July 2026.

ABDLBSEDEFENCEGROWWPOWERGVPILHGINFRAKMEWKRISHNADEFLLOYDSLLOYDSENGGLLOYDSENTMBELPARASRSYSTEMSSMARTENTDPOWERSYSUTLSOLARWELCORPWELENTCapital GoodsConstruction
Global Market Update: Europe's STOXX 600 hits record high, eyes best weekly gain since mid-May
positive
ET Markets - Stocks 8d ago

Global Market Update: Europe's STOXX 600 hits record high, eyes best weekly gain since mid-May

Europe's STOXX 600 hovered near record highs on Friday and headed for its best week since mid-May, supported by gains in defence and cyclical stocks. Investors shrugged off near-term US rate concerns as easing Middle East tensions broadened the rally beyond technology shares. Siemens led gains in Germany, while defence stocks benefited from expectations of higher military spending amid escalating geopolitical risks.

DEFENCEGLOBALSIEMENSCapital GoodsConsumer Services
ICICI Pru's S Naren expects moderate market returns, backs gold in diversified portfolios
positive
CNBC TV18 - Markets 9d ago

ICICI Pru's S Naren expects moderate market returns, backs gold in diversified portfolios

S Naren, Executive Director and CIO of ICICI Prudential AMC, which managed funds worth $3 billion as of May 31, 2026, said improving macro conditions have strengthened India's outlook but global AI-led capital flows continue to favour overseas markets. Naren reiterated his preference for diversified multi-asset investing over concentrated equity or standalone gold ETF exposure.

AKCAPITALPHAETFALPL30IETFAONEGOLDAONETMMQ50AONETOTALARIHANTCAPAUTOIETFAXISBPSETFBANKETFBANKIETFBANKPSUBBNPPGOLDBFSIBSE500IETFBSLGOLDETFCASHIETFCHOICEGOLDCOMMOIETFCONSUMERCONSUMIETFCPCAPDEFENCEDIVIDENDECAPINSUREEGOLDENERGYEQUAL200EQUAL50ESGEVIETFEVINDIAFINIETFFMCGIETFGLOBALGOLD360GOLDADDGOLDAXISGOLDBEESGOLDBNDGOLDCASEGOLDETFGOLDIETFGROWWCAPMGROWWGOLDGSEC10IETFGSEC10YEARGSEC5IETFHEALTHCAREHEALTHIETFHSBCGOLDICICIAMCICICIB22ICICIPRULIINFRAINFRAIETFINTERNETITETFITIETFLIQUIDLIQUIDIETFLIQUIDPLUSLOWVOLLOWVOLIETFMAFANGMAHKTECHMAKEINDIAMASPTOP50METALMETALIETFMIDCAPETFMIDCAPIETFMIDSELIETFMIDSMALLMOCAPITALMOGOLDMOM30IETFMULTICAPNEXT50NEXT50IETFNIF100IETFNIFTYETFNIFTYIETFNV20IETFOILIETFPSUBNKIETFPVTBANIETFQGOLDHALFQUAL30IETFSDL26BEESSELECTIPOSENSEXETFSENSEXIETFSETFGOLDSILVERAGSILVERIETFSMALL250SMALLCAPTOP15IETFTOP20TWCGOLDETFUNIONGOLDVAL30IETFVALUEConsumer ServicesFinancial Services
The surprising reason India's most expensive stocks often keep rising
positive
ET Markets - Stocks 9d ago

The surprising reason India's most expensive stocks often keep rising

Indian stocks defy logic, with expensive companies consistently outperforming. This trend, observed over 15 years, sees sectors like defence and retail surge despite high valuations, driven by structural shifts and strong earnings. Jefferies highlights the power sector as the next potential beneficiary, citing strong demand and private sector capex. Investors should remain aware of potential reversals if growth falters.

DEFENCEGVPILHDFCGROWTHRETAILSDREAMSV2RETAILCapital GoodsConsumer Services
BSE launches Reits index; Waterways Leisure Tourism sinks on debut
positive
Business Standard - Markets 9d ago

BSE launches Reits index; Waterways Leisure Tourism sinks on debut

BSE launches a REIT-focused index as mutual funds gear up for new schemes, while Waterways Leisure debuts at a discount and Advit Jewels lists with strong gains

BANK10ADDBSECORDELIADEFENCEDIVIDENDECAPINSUREEQUAL200ESENSEXGROWWEVGROWWHOSPIGROWWPOWERMOBANK10MOHEALTHMOINFRAMOIPOMOLOWVOLMOQUALITYMOTOURMOVALUENEXT30ADDRAMBHAJOSBIBPBSELECTIPOSENSEXAXISSENSEXETFSNXT30BEESConsumer DurablesConsumer Services
Edelweiss AMC crosses ₹1 trn milestone in equity assets under management
positive
Business Standard - Markets 10d ago

Edelweiss AMC crosses ₹1 trn milestone in equity assets under management

The asset manager attributed the milestone to consistent fund performance, wider distribution and sustained retail participation through systematic investment plans across market cycles

ALPHAETFAONETOTALBANKETFBANKPSUBBETF0432BFINVESTBFSICRAMCDEFENCEDIVIDENDEBANKNIFTYEBBETF0430EBBETF0431EBBETF0433ECAPINSUREEDELWEISSEGOLDELIQUIDELM250ENERGYENIFTYEQUAL200EQUAL50ESENSEXESGESILVERGOLDETFGSEC10YEARHDFCAMCHEALTHCAREICICIAMCINTERNETITETFLIQUIDLIQUIDPLUSLOWVOLMAFANGMAGSONMAHKTECHMAKEINDIAMASPTOP50METALMIDCAPETFMOCAPITALMULTICAPNAM-INDIANEXT50NIFTYETFRETAILSDREAMSSELECTIPOSENSEXETFSILVERAGSMALL250TOP20UTIAMCV2RETAILVALUEConsumer ServicesFinancial Services
Paras Defence partners with Powerus to manufacture Guardian-1 counter-drone system
positive
CNBC TV18 - Markets 10d ago

Paras Defence partners with Powerus to manufacture Guardian-1 counter-drone system

Shares of Paras Defence and Space Technologies Ltd ended at ₹1,289.25, up by ₹105.45, or 8.91%, on the BSE.

BSEDEFENCEDRONEPARASCapital GoodsConsumer Services
NEWS
neutral
Business Standard - Markets 11d ago

Ola Electric Mobility Ltd leads gainers in 'A' group

Morepen Laboratories Ltd, Paras Defence and Space Technologies Ltd, Arvind Ltd and Capri Global Capital Ltd are among the other gainers in the BSE's 'A' group today, 30 June 2026.

AKCAPITARVINDBSECGCLCPCAPDEFENCEECAPINSUREGLOBALMOREPENLABOLAELECPARASAutomobile and Auto ComponentsCapital Goods
Amber Group eyes $2 billion revenue milestone soon; invests Rs 6,750 crore in UP projects
positive
ET Markets - Industry 13d ago

Amber Group eyes $2 billion revenue milestone soon; invests Rs 6,750 crore in UP projects

Amber Group is poised to reach USD 2 billion in revenue soon, fueled by robust growth in its consumer durables, electronics, and railway/defence sectors. The company recently broke ground on a significant Rs 6,785 crore manufacturing expansion in Jewar, Uttar Pradesh. This includes a crucial PCB and semiconductor substrate unit via a joint venture, alongside an expanded air-conditioner complex, aiming for import substitution and future exports.

AMBERCONSUMERDEFENCEFELFELDVRHDFCGROWTHLGEINDIARPPINFRAConstructionConsumer Durables
Why Boeing and Airbus could be a game changer for some Indian auto stocks
positive
CNBC TV18 - Markets 15d ago

Why Boeing and Airbus could be a game changer for some Indian auto stocks

Indian auto component makers expanding into aerospace and defence could unlock a significant new growth avenue, according to fund manager Rajesh Kothari. He believes even a small share of sourcing by global aircraft giants such as Boeing and Airbus could potentially double or triple revenues for some suppliers over time.

AONELIQUIDAUTOBEESAUTOIETFBBETF0432DEFENCEGLOBALGROWWDEFNCGROWWEVHDFCGROWTHLIQGRWBEESLIQUIDPLUSMODEFENCEMOGSECSBILIQETFConsumer ServicesFinancial Services