Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:LGEINDIAConsumer Services
Clear all filters
Amber Group eyes $2 billion revenue milestone soon; invests Rs 6,750 crore in UP projects
positive
ET Markets - Industry 14d ago

Amber Group eyes $2 billion revenue milestone soon; invests Rs 6,750 crore in UP projects

Amber Group is poised to reach USD 2 billion in revenue soon, fueled by robust growth in its consumer durables, electronics, and railway/defence sectors. The company recently broke ground on a significant Rs 6,785 crore manufacturing expansion in Jewar, Uttar Pradesh. This includes a crucial PCB and semiconductor substrate unit via a joint venture, alongside an expanded air-conditioner complex, aiming for import substitution and future exports.

AMBERCONSUMERDEFENCEFELFELDVRHDFCGROWTHLGEINDIARPPINFRAConstructionConsumer Durables
ET Graphics: From budget to premium, gadget Prices Rise
positive
ET Markets - Industry 15d ago

ET Graphics: From budget to premium, gadget Prices Rise

Indian consumers are facing a significant price hike on smartphones, laptops, and tablets, impacting both budget and premium devices. This surge is primarily due to a global shortage of essential memory chips, as manufacturers divert production towards lucrative AI data center components. A weakening rupee further exacerbates this inflationary trend, making electronics increasingly expensive for the masses.

GLOBALLGEINDIAPREMIUMAutomobile and Auto ComponentsConsumer Durables
Apple supplier Tata Electronics tightens internal controls after data breach
neutral
ET Markets - Industry 15d ago

Apple supplier Tata Electronics tightens internal controls after data breach

Tata Electronics is investigating a massive data leak on the dark web, reportedly exposing thousands of secret client files from Apple and Tesla. The company has restricted internal system access, hired a global consultant for a forensic audit, and informed authorities and clients. Apple's security team is actively collaborating with Tata on mitigation efforts following this significant cybersecurity incident.

GLOBALLGEINDIATATATECHConsumer DurablesConsumer Services
RIL, BEL, Lenskart, Delhivery among Motilal Oswal's top monthly picks
positive
Business Standard - Markets 17d ago

RIL, BEL, Lenskart, Delhivery among Motilal Oswal's top monthly picks

Top monthly stock picks by Motilal Oswal Wealth Management Research Desk: Analysts are bullish on Reliance, Bharat Electronics, ACME Solar, Delhivery, Gokaldas Exports and Lenskart.

ACMESOLARBELDELHIVERYGOKEXJAROLENSKARTLGEINDIAMOALPHA50MOBANK10MOCAPITALMODEFENCEMOENERGYMOGOLDMOGSECMOHEALTHMOINFRAMOIPOMOLOWVOLMOM100MOM50MOMENTUM50MOMGFMOMIDMTMMOMNCMOMOMENTUMMON100MON50EQUALMONEXT50MONIFTY100MONIFTY500MONQ50MOPSEMOQUALITYMOREALTYMOSERVICEMOSILVERMOSMALL250MOTILALOFSMOTOURMOVALUENUVAMARELIANCERELINFRASOLARINDSWEALTHCapital GoodsChemicals
Syrma SGS Technology shares jump 5% after JV pact with Japan’s Kaga Electronics
positive
ET Markets - Stocks 18d ago

Syrma SGS Technology shares jump 5% after JV pact with Japan’s Kaga Electronics

Syrma SGS Technology's shares jumped nearly 5% after announcing a significant joint venture with Japan's Kaga Electronics. This collaboration aims to establish a cutting-edge manufacturing facility in India, primarily serving Japanese clients and bolstering Syrma's presence in high-value electronics. The partnership, with Syrma holding a 60% stake, is seen as a strategic move to capitalize on global supply chain diversification and India's growing appeal for Japanese manufacturing expansion.

BMETRICSGLOBALLGEINDIASYRMATVSSCSVALUECapital GoodsConsumer Durables
Stocks to Watch for June 23: Info Edge, Bharat Electronics, Hindustan Zinc and more
positive
CNBC TV18 - Markets 19d ago

Stocks to Watch for June 23: Info Edge, Bharat Electronics, Hindustan Zinc and more

From Info Edge informing that its artificial intelligence startup portfolio has grown to ₹1,268 crore from investments of ₹614 crore across 28 companies to BEL receiving an additional orders worth ₹1,081 crore; here are some stocks to track ahead of Tuesday's trading session.

BELHINDZINCLGEINDIANAUKRICapital GoodsConsumer Durables
LG Electronics remains Chola Securities' top pick in the consumer durables space
positive
CNBC TV18 - Markets 20d ago

LG Electronics remains Chola Securities' top pick in the consumer durables space

Dharmesh Kant, Head of Research at Chola Securities, believes Reliance Jio's upcoming IPO is fairly valued and could deliver 20-25% listing gains as investors assign a premium to emerging businesses such as AI, data centres and satellite services. He expects these segments to contribute more than half of Jio's revenue over the next decade. Kant is positive on consumer durables and LG Electronics, remains cautious on IT stocks beyond short-term trading opportunities, and sees limited structural upside in paint companies despite improving margins. Disclaimer: The views and investment tips expressed by investment experts on CNBCTV18.com are their own and not that of the website or its management. CNBCTV18.com advises users to check with certified experts before taking any investment decisions.

BFINVESTCONSUMERJAROLGEINDIAPREMIUMRELIANCERELINFRAAutomobile and Auto ComponentsConsumer Durables
Trade Spotlight: How should you trade PhysicsWallah, LG Electronics, Indian Hotels, Anand Rathi Wealth,... - Moneycontrol.com
neutral
Google News - India Markets 20d ago

Trade Spotlight: How should you trade PhysicsWallah, LG Electronics, Indian Hotels, Anand Rathi Wealth,... - Moneycontrol.com

Trade Spotlight: How should you trade PhysicsWallah, LG Electronics, Indian Hotels, Anand Rathi Wealth,...Moneycontrol.com

ANANDRATHIARSSBLINDHOTELLGEINDIAPWLWEALTHConsumer DurablesConsumer Services
Street Signals: Technical charts point to further upside for Nifty
positive
ET Markets - Stocks 20d ago

Street Signals: Technical charts point to further upside for Nifty

Indian stock markets are showing a positive outlook, with analysts predicting the Nifty could climb towards 24,300-24,600. Key support levels are identified around 23,700-23,900, encouraging investors to buy on dips. Several stocks, including Britannia Industries, Grasim Industries, Aditya Birla Capital, Premier Energies, Bharat Electronics, and Eternal, are highlighted as top picks for the week, with specific buy recommendations and targets.

ABCAPITALABFRLABGSECABLBLABRELABSL10BANKABSLAMCABSLBANETFABSLLIQUIDABSLNN50ETABSLPSEAKCAPITARIHANTCAPBELBIRLACORPNBIRLAMONEYBRITANNIABSLGOLDETFBSLNIFTYBSLSENETFGCPCAPECAPINSUREETERNALGRASIMGROWWCAPMGSEC10ABSLHEALTHYLGEINDIAMOCAPITALMOMENTUMNIFTYQLITYPREMIERPREMIERENESDL26BEESSILVERTECHTOP10ADDTOP15IETFTOP20Capital GoodsConstruction Materials
Reliance AGM: Reliance Retail bets on AI and consumer intelligence to power next phase of growth
positive
LiveMint - Markets 22d ago

Reliance AGM: Reliance Retail bets on AI and consumer intelligence to power next phase of growth

Reliance Retail reported strong growth in FY26, driven by quick commerce, grocery network expansion, and rising consumer demand in fashion and electronics. The company plans to leverage AI and consumer insights for future growth, aiming for ₹1 lakh crore revenue by FY30.

ABFRLBELLACASACONSUMERFELFELDVRGOCOLORSGVPILLGEINDIARELIANCERELINFRARETAILRPOWERSDREAMSV2RETAILCapital GoodsConsumer Durables
Why Investec is bullish on India's electronics export story
positive
CNBC TV18 - Markets 25d ago

Why Investec is bullish on India's electronics export story

India's recent trade agreements and rising investments in manufacturing are helping improve the country's position in global supply chains. According to Investec Capital Services' Head Equities Mukul Kochhar, electronics exports are among the best-placed segments to benefit from this trend. Besides EMS, he sees strong opportunities in original design manufacturing (ODM) and defense electronics as Indian companies deepen their presence in the global electronics market. Disclaimer: The views and investment tips expressed by investment experts on CNBCTV18.com are their own and not that of the website or its management. CNBCTV18.com advises users to check with certified experts before taking any investment decisions.

AKCAPITAVONMOREBFINVESTCPCAPEMSLIMITEDGLOBALLGEINDIAMOCAPITALConsumer DurablesConsumer Services
The Next Frontier: LG's future is not just the TV and fridge in your home
positive
ET Markets - Industry 25d ago

The Next Frontier: LG's future is not just the TV and fridge in your home

LG Electronics is accelerating its transformation: LG Electronics is transforming from a home appliance maker to a technology powerhouse. The company is expanding into recurring services and business-to-business solutions. LG is also investing heavily in AI infrastructure and robotics. This strategic shift aims to build stable, high-margin businesses. The vision includes a 'Zero Labor Home' where robots support human life.

ABSLNN50ETFELFELDVRLGEINDIATVVISIONConsumer DurablesConsumer Services