Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:MEDANTAConsumer Services
Clear all filters
NEWS
positive
Business Standard - Markets 23d ago

New India Assurance Company Ltd leads gainers in 'A' group

Galaxy Surfactants Ltd, Star Health & Allied Insurance Company Ltd, FSN E-Commerce Ventures Ltd and R R Kabel Ltd are among the other gainers in the BSE's 'A' group today, 18 June 2026.

BSEECAPINSUREGALAXYSURFMEDANTANIACLNIVABUPANYKAARRKABELSTARSTARHEALTHCapital GoodsChemicals
JM Fin on insurance: Retail health to drive growth; Star Health top pick
positive
Business Standard - Markets 24d ago

JM Fin on insurance: Retail health to drive growth; Star Health top pick

The brokerage said that it prefers Star Health in the space as it has recommended a 'Buy' rating on the stock for a target price of ₹650.

MEDANTANIVABUPARETAILSDREAMSSTARSTARHEALTHV2RETAILConsumer ServicesFinancial Services
Public-private projects key to expand access to Kidney care: NephroPlus
positive
ET Markets - Industry 25d ago

Public-private projects key to expand access to Kidney care: NephroPlus

NephroPlus, India's leading provider of dialysis services, is on a mission to reshape the future of kidney health with an innovative tech-based platform aimed at preventing chronic kidney disease. As it scales up its network of dialysis centers both domestically and in global markets, this forward-thinking initiative seeks to combat the advancement of kidney ailments.

AGARWALEYEAMRUTANJANFELFELDVRGLOBALHEALTHXMEDANTANEPHROPLUSPGHHRPPINFRATECHZOTAZTECHConstructionConsumer Services
AB Group reaffirms bet on Voda Idea with ₹4,730 Cr infusion
positive
ET Markets - Industry 30d ago

AB Group reaffirms bet on Voda Idea with ₹4,730 Cr infusion

Vodafone Idea shareholders approved a ₹4,730-crore investment from the Aditya Birla Group via preferential allotment of warrants, increasing AB Group's stake to around 13%. Chairman Kumar Mangalam Birla stated the company's focus now shifts to execution across operations, customer service, and network expansion. This capital infusion will support capital expenditure and loan repayment, reinforcing Vi's financial health.

ABCAPITALABFRLABGSECABLBLABRELABSL10BANKABSLAMCABSLBANETFABSLLIQUIDABSLNN50ETABSLPSEAKCAPITBFINVESTBIRLACORPNBIRLAMONEYBSLGOLDETFBSLNIFTYBSLSENETFGCPCAPFOCUSGSEC10ABSLHEALTHYIDEAJMFINANCILMANGALAMMEDANTAMGELMOMENTUMNAHARCAPNIFTYQLITYSERVICESILVERTECHConstruction MaterialsConsumer Durables
Stock Alert: SBI, Aurionpro Solutions, MedPlus Health, Honasa Consumer, Bharat Wire Ropes, IOL Chemicals & Pharma - Business Standard
positive
Google News - India Markets 30d ago

Stock Alert: SBI, Aurionpro Solutions, MedPlus Health, Honasa Consumer, Bharat Wire Ropes, IOL Chemicals & Pharma - Business Standard

Stock Alert: SBI, Aurionpro Solutions, MedPlus Health, Honasa Consumer, Bharat Wire Ropes, IOL Chemicals & PharmaBusiness Standard

AURIONPROBHARATWIRECONSUMERHONASAIOLCPJGCHEMMEDANTAMEDPLUSSILCapital GoodsChemicals
ICICI Lombard: AI Integration Lifts Growth Outlook — Buy, Sell or Hold? Read Motilal Oswal's Analysis
positive
NDTV Profit 31d ago

ICICI Lombard: AI Integration Lifts Growth Outlook — Buy, Sell or Hold? Read Motilal Oswal's Analysis

Leadership in motor insurance, accelerating momentum in retail health, expanding distribution capabilities, growing AI integration and a strong balance sheet remains ICICI Lombard's key growth drivers.

CASHIETFICICIGIICICIPRULIMAGSONMEDANTAMOALPHA50MOBANK10MOCAPITALMODEFENCEMOENERGYMOGOLDMOGSECMOHEALTHMOINFRAMOIPOMOLOWVOLMOM100MOM30IETFMOM50MOMENTUMMOMENTUM50MOMGFMOMIDMTMMOMNCMOMOMENTUMMON100MON50EQUALMONEXT50MONIFTY100MONIFTY500MONQ50MOPSEMOQUALITYMOREALTYMOSERVICEMOSILVERMOSMALL250MOTILALOFSMOTOURMOVALUENIVABUPARETAILSDREAMSSTARHEALTHV2RETAILConsumer ServicesFinancial Services
A new-age thirst for beverages is emerging as a key force in India's consumer goods market
positive
ET Markets - Industry 32d ago

A new-age thirst for beverages is emerging as a key force in India's consumer goods market

Beverage industry in India: Indian companies are seeing strong growth in drinks like coffee, ready-to-drink options, and protein beverages. Younger consumers are driving this trend, seeking convenience and health. Companies are expanding their offerings to meet this demand. This shift presents significant opportunities for future expansion in the Indian beverage market.

CONSUMEREVIETFEVINDIAFELFELDVRFMNLGROWWEVMEDANTAVINCOFEConsumer ServicesFinancial Services
Carlyle-backed Viyash Scientific buys Italy’s BioForLife for Rs 188 crore
positive
ET Markets - Industry 33d ago

Carlyle-backed Viyash Scientific buys Italy’s BioForLife for Rs 188 crore

Viyash Scientific, backed by Carlyle, is acquiring Italy's BioForLife for Rs. 188 crore. This move aims to build a leading global companion animal health business. BioForLife offers a strong presence in the Italian pet care market. The acquisition is expected to finalize in the second quarter of FY 2026-27.

AGARWALEYEAMRUTANJANGLOBALGLOBALPETMEDANTAPGHHVIYASHZOTACapital GoodsConsumer Services
Manipal Health takes Bengaluru hospital building on long-term lease
positive
ET Markets - Industry 37d ago

Manipal Health takes Bengaluru hospital building on long-term lease

Manipal Health Enterprises has leased a 245,000-sq ft multi-speciality hospital in Bengaluru's Yelahanka for nearly 30 years, with an estimated total rental outgo of ₹816.1 crore. The lease agreement includes a starting monthly rent of ₹1.27 crore and a 10% rent escalation in the sixth year.

LTGILTBEESMEDANTASPECIALITYTOTALConsumer ServicesFinancial Services
Manipal Health picks up hospital building in Bengaluru through 30-year lease
positive
ET Markets - Industry 37d ago

Manipal Health picks up hospital building in Bengaluru through 30-year lease

Manipal Health Enterprises has secured a large hospital building in Bengaluru's Yelahanka area. The lease spans nearly 30 years, with total rental payments projected at over Rs 816 crore. This move signifies the hospital chain's ongoing expansion across major Indian cities. The transaction underscores the growing trend of healthcare operators prioritizing long-term occupancy in prime urban markets.

HCGHCG-REHEALTHCARELTGILTBEESMEDANTATOTALURBANURBANCOConsumer ServicesFinancial Services
Zydus Semaglutide approval: Delhi HC directs CDSCO to decide on patient safety concerns
positive
ET Markets - Industry 38d ago

Zydus Semaglutide approval: Delhi HC directs CDSCO to decide on patient safety concerns

The Delhi High Court has asked the Central Drugs Standard Control Organisation to review a petition challenging Zydus Lifesciences' approval for semaglutide injections. A diabetes patient raised concerns about the drug's delivery system, alleging it deviates from global standards and poses health risks. The court has directed the CDSCO to consider the patient's representation within two months.

GLOBALMEDANTASILZYDUSLIFEConsumer ServicesHealthcare
Health services, medical education expansion to be driven by modern tech: Yogi Adityanath
positive
ET Markets - Industry 46d ago

Health services, medical education expansion to be driven by modern tech: Yogi Adityanath

Uttar Pradesh Chief Minister Yogi Adityanath reviewed health and medical education. He stressed improving treatment quality and expanding services. Medical colleges and nursing institutions will be strengthened with modern technology. Ayushman Yojana support for the poor was highlighted. Efforts are underway to enhance emergency services and control communicable diseases.

GLOBALMEDANTATECHZTECHConsumer ServicesFinancial Services