Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:MEDANTAFast Moving Consumer Goods
Clear all filters
Chips or chocolates, India's brands want you to pay more for a fitter you
positive
ET Markets - Industry 15d ago

Chips or chocolates, India's brands want you to pay more for a fitter you

From millet chips and protein-rich chocolates to science-backed skincare, FMCG companies are increasingly premiumising everyday products to drive growth beyond volumes. Backed by rising demand for health, nutrition and convenience, brands are leveraging trusted names to launch higher-margin variants, while industry data shows premium categories continuing to outpace the broader market despite concerns over whether healthier claims always translate into better nutrition.

MEDANTAPREMIUMSHANTHALAAutomobile and Auto ComponentsFast Moving Consumer Goods
CDSCO asks states, port offices to step up screening to curb imports of illegal drugs
negative
ET Markets - Industry 15d ago

CDSCO asks states, port offices to step up screening to curb imports of illegal drugs

India's drug regulator is intensifying border screenings to block unapproved medicines from entering the country. Authorities are cracking down on illegal import channels and boosting surveillance in vulnerable areas like coastal regions and logistics hubs. State drug controllers are urged to gather intelligence and work with law enforcement to seize and prosecute those involved in the unauthorized trade of medicines, safeguarding public health.

BRACEPORTCOASTCORPMEDANTASJLOGISTICFast Moving Consumer GoodsHealthcare
Mamaearth Enters 'Beauty-From-Within' Segment As Parent Honasa Acquires 58% In Nutraceuticals Firm
positive
NDTV Profit 18d ago

Mamaearth Enters 'Beauty-From-Within' Segment As Parent Honasa Acquires 58% In Nutraceuticals Firm

The company will enter the category by establishing a dedicated subsidiary, Honasa Health Pvt.

HONASAMEDANTAFast Moving Consumer GoodsHealthcare
Honasa Consumer enters nutraceuticals segment; to acquires 58 pc stake in Fluence Pharma
positive
ET Markets - Industry 18d ago

Honasa Consumer enters nutraceuticals segment; to acquires 58 pc stake in Fluence Pharma

Honasa Consumer, parent of Mamaearth, is acquiring a 58% stake in nutraceuticals firm Fluence Pharma for Rs 135 crore, marking its entry into the health and wellness supplements market. This strategic move aims to leverage Fluence's patented technology and dermatologist network to expand Honasa's 'inside-out' beauty solutions. The acquisition is expected to significantly boost Honasa's growth by diversifying its product portfolio into the rapidly expanding Indian nutraceuticals sector.

CONSUMERHONASAMEDANTAFast Moving Consumer GoodsFinancial Services
NEWS
positive
Business Standard - Markets 23d ago

Volumes jump at Procter & Gamble Hygiene and Health Care Ltd counter

Procter & Gamble Hygiene and Health Care Ltd saw volume of 6.2 lakh shares by 10:47 IST on BSE, a 320.13 fold spurt over two-week average daily volume of 1937 shares

AGARWALEYEAMRUTANJANBSEMEDANTAMHHLPGHHPGHLZOTAFast Moving Consumer GoodsFinancial Services
Stock Picks Today: Tata Motors PV, Shyam Metalics, Titan, Max Health, United Spirits, Thyrocare And More On Brokerages' Radar
positive
NDTV Profit 23d ago

Stock Picks Today: Tata Motors PV, Shyam Metalics, Titan, Max Health, United Spirits, Thyrocare And More On Brokerages' Radar

Brokerages' Radar

MAXINDMEDANTASHYAMMETLTATATECHTHYROCARETITANTMCVTMPVUNITDSPRAutomobile and Auto ComponentsCapital Goods
India makes gains in child, maternal health but nutrition challenges persist: SBI report
positive
ET Markets - Industry 24d ago

India makes gains in child, maternal health but nutrition challenges persist: SBI report

India's latest health survey reveals significant improvements in maternal care and child vaccination rates. Stunting among children has seen a notable decline. However, modest gains in underweight and wasting indicate a need for comprehensive nutrition strategies. The survey also points to a rise in obesity among women. Fertility rates are stable, and women's financial inclusion has strengthened.

AGARWALEYEAMRUTANJANGAUDIUMIVFJMFINANCILMEDANTAPGHHZOTAFast Moving Consumer GoodsFinancial Services
Public-private projects key to expand access to Kidney care: NephroPlus
positive
ET Markets - Industry 25d ago

Public-private projects key to expand access to Kidney care: NephroPlus

NephroPlus, India's leading provider of dialysis services, is on a mission to reshape the future of kidney health with an innovative tech-based platform aimed at preventing chronic kidney disease. As it scales up its network of dialysis centers both domestically and in global markets, this forward-thinking initiative seeks to combat the advancement of kidney ailments.

AGARWALEYEAMRUTANJANFELFELDVRGLOBALHEALTHXMEDANTANEPHROPLUSPGHHRPPINFRATECHZOTAZTECHConstructionConsumer Services
After Nestle, FSSAI Issues Notices To Eight Brands For Misleading Trade Names, Healthy Claims — Check Full List
positive
NDTV Profit 27d ago

After Nestle, FSSAI Issues Notices To Eight Brands For Misleading Trade Names, Healthy Claims — Check Full List

FSSAI has issued notices to Emami Healthy & Tasty, Health Aid, Troovy, The Healthy Factory, Healthy Master, Healthy Choice, Plan B and Neuherbs.

CHOICEINEMAMILTDHEALTHYMASTERMEDANTANESTLEINDCapital GoodsFast Moving Consumer Goods
NEWS
positive
Business Standard - Markets 29d ago

Alembic Pharmaceuticals receives USFDA approval for Tretinoin Cream USP, 0.05%

Alembic Pharmaceuticals (Alembic) today announced that it has received final approval from the US Food & Drug Administration (USFDA) for its Abbreviated New Drug Application (ANDA) Tretinoin Cream USP, 0.05%. The approved ANDA is therapeutically equivalent to the reference listed drug product (RLD), Retin-A Cream, 0.05%, of Bausch Health US, LLC. Tretinoin cream is indicated for topical application in the treatment of acne vulgaris.

ALEMBICLTDAPLLTDMEDANTAMVKAGROFast Moving Consumer GoodsHealthcare
AB Group reaffirms bet on Voda Idea with ₹4,730 Cr infusion
positive
ET Markets - Industry 30d ago

AB Group reaffirms bet on Voda Idea with ₹4,730 Cr infusion

Vodafone Idea shareholders approved a ₹4,730-crore investment from the Aditya Birla Group via preferential allotment of warrants, increasing AB Group's stake to around 13%. Chairman Kumar Mangalam Birla stated the company's focus now shifts to execution across operations, customer service, and network expansion. This capital infusion will support capital expenditure and loan repayment, reinforcing Vi's financial health.

ABCAPITALABFRLABGSECABLBLABRELABSL10BANKABSLAMCABSLBANETFABSLLIQUIDABSLNN50ETABSLPSEAKCAPITBFINVESTBIRLACORPNBIRLAMONEYBSLGOLDETFBSLNIFTYBSLSENETFGCPCAPFOCUSGSEC10ABSLHEALTHYIDEAJMFINANCILMANGALAMMEDANTAMGELMOMENTUMNAHARCAPNIFTYQLITYSERVICESILVERTECHConstruction MaterialsConsumer Durables
How Gen Z became the most important customer in FMCG
positive
ET Markets - Industry 30d ago

How Gen Z became the most important customer in FMCG

Young consumers are now driving major decisions at established food companies. Gen-Z and millennials are influencing product development, acquisitions, and marketing strategies. These younger shoppers are health-conscious, digitally savvy, and demand transparency. Their preferences are reshaping the entire packaged foods industry in India.

LTFOODSMEDANTAMVKAGROFast Moving Consumer GoodsHealthcare