Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:RSYSTEMSOil Gas & Consumable Fuels
Clear all filters
NTPC installs 5 GWh battery storage at coal plants in Rs 5,000 crore push to cut renewable curtailment
positive
ET Markets - Industry 23d ago

NTPC installs 5 GWh battery storage at coal plants in Rs 5,000 crore push to cut renewable curtailment

NTPC is installing 5 gigawatt-hours of battery storage at its coal power plants. This initiative aims to reduce renewable energy that goes unused. The investment is around 5,000 crore rupees. These battery systems will absorb excess solar and wind power. The Central Electricity Regulatory Commission has approved a tariff structure for these projects.

BFINVESTBGRENERGYCOALINDIADPELENERGYGKENERGYGVPILIREDAKPELNTPCNTPCGREENPOWERMECHRPPINFRARSYSTEMSSERVOTECHSMARTENSOLARINDSSWELECTESSWSOLARTDPOWERSYSUTLSOLARCapital GoodsChemicals
NEWS
negative
Business Standard - Markets 31d ago

Oil India Ltd leads losers in 'A' group

Avalon Technologies Ltd, TD Power Systems Ltd, IFCI Ltd and Manappuram Finance Ltd are among the other losers in the BSE's 'A' group today, 10 June 2026.

AVALONBSEGROWWPOWERGVPILIFCILTFMANAPPURAMOILPFCRSYSTEMSSMARTENTDPOWERSYSUTLSOLARCapital GoodsFinancial Services
Pharma in her DNA, Wockhardt scion ready for deep dive in the US
positive
ET Markets - Industry 32d ago

Pharma in her DNA, Wockhardt scion ready for deep dive in the US

Zahabiya Khorakiwala is leading Wockhardt's US business and the launch of its new antibiotic, Zaynich. This drug targets resistant bacterial infections and is a significant bet for the company. Zaynich's US approval marks a major breakthrough after decades without new antibiotics. Zahabiya is focused on hospital penetration, physician advocacy, and demonstrating economic value to healthcare systems.

DEEPINDSHCGHCG-REHEALTHCARERSYSTEMSVALUEWOCKPHARMAFinancial ServicesHealthcare
Dipan Mehta picks Coforge, Persistent and Happiest Minds for the AI era
positive
CNBC TV18 - Markets 37d ago

Dipan Mehta picks Coforge, Persistent and Happiest Minds for the AI era

Dipan Mehta, Director at Elixir Equities, said new-age IT firms such as Happiest Minds, Persistent Systems and Coforge are well placed to benefit from the AI-led disruption in technology services. He also favoured diversified NBFCs over banks and highlighted opportunities in mining companies like NMDC and Hindustan Copper. However, he cautioned that elevated crude oil prices and the ongoing Iran conflict could weigh on India's economic growth and market sentiment. Disclaimer: The views and investment tips expressed by investment experts on CNBCTV18.com are their own and not that of the website or its management. CNBCTV18.com advises users to check with certified experts before taking any investment decisions.

BFINVESTCAMSCOFORGECONSUMEREVIETFEVINDIAGROWWEVHAPPSTMNDSHINDCOPPERHINDOILEXPNMDCOILPERSISTENTRSYSTEMSFinancial ServicesInformation Technology
Q4 Results Today: Patanjali Foods, Easy Trip Planners, Gujarat Gas, Among Over 600 Firms To Declare Earnings
positive
NDTV Profit 42d ago

Q4 Results Today: Patanjali Foods, Easy Trip Planners, Gujarat Gas, Among Over 600 Firms To Declare Earnings

Jupiter Wagons, Titagarh Rail Systems, Som Distilleries & Breweries and Jindal Poly Films will also declare Q4FY26 results on May 30.

EASEMYTRIPGMBREWGUJENERGYJINDALPOLYJPOLYINVSTJWLLTFOODSNAHARPOLYPATANJALIRSYSTEMSSDBLTITAGARHCapital GoodsConsumer Services
Reliance in talks with Chinese battery behemoth CATL & others for big battery system parts
positive
ET Markets - Industry 53d ago

Reliance in talks with Chinese battery behemoth CATL & others for big battery system parts

Reliance Industries is in talks with China’s Contemporary Amperex Technology Co. Limited and other global suppliers to source components for battery energy storage systems as it pushes ahead with its clean energy plans.

BGRENERGYCLEANCLEANMAXENERGYGKENERGYGLOBALKPELRELIANCERELINFRARSYSTEMSSWELECTESWEBELSOLARCapital GoodsChemicals
Q1 fuel losses may eliminate entire fiscal-year earnings of Indian OMCs
negative
ET Markets - Stocks 61d ago

Q1 fuel losses may eliminate entire fiscal-year earnings of Indian OMCs

Since the war broke out in the Middle East 10 weeks ago, state-owned oil marketing companies (OMCs) have ensured uninterrupted supplies of petrol, diesel and cooking gas LPG at rates that are way below cost, unlike many global energy systems that imposed rationing or passed through steep price increases.

BGRENERGYENERGYGKENERGYGLOBALIEXIOCIREDAKPELOILOILIETFONGCRSYSTEMSSWELECTESCapital GoodsConstruction
Gujarat builds 870 MW battery power backup network to stabilise renewable energy grid
positive
ET Markets - Industry 63d ago

Gujarat builds 870 MW battery power backup network to stabilise renewable energy grid

Gujarat has launched battery storage systems totaling 870 MW across five locations to ensure renewable power grid stability. The state has also registered 13 additional projects and integrated BESS with its first solar village, Modhera. This initiative strengthens Gujarat's position as a leader in battery storage solutions in India.

BGRENERGYDPELENERGYGIPCLGKENERGYGSFCGSPLGVPILIREDAKPELPIGLPOWERGRIDPOWERMECHRPPINFRARSYSTEMSSERVOTECHSMARTENSOLARINDSSWELECTESSWSOLARTDPOWERSYSUTLSOLARCapital GoodsChemicals
The Price Of Building What Lasts | The Week In Whys
negative
NDTV Profit 63d ago

The Price Of Building What Lasts | The Week In Whys

Oil, markets and research shape the systems driving an uncertain global economy.

GLOBALOILRSYSTEMSConsumer ServicesInformation Technology
NEWS
positive
Business Standard - Markets 64d ago

Maral Overseas Ltd leads gainers in 'B' group

Anuroop Packaging Ltd, Cybertech Systems & Software Ltd, We Win Ltd and Sandur Manganese & Iron Ores Ltd are among the other gainers in the BSE's 'B' group today, 08 May 2026.

BSECYBERTECHMARALOVERRSSOFTWARERSYSTEMSSANDUMAWEWINFinancial ServicesInformation Technology
NEWS
positive
Business Standard - Markets 67d ago

Infosys completes acquisition of Optimum Healthcare IT

The acquisition of Optimum Healthcare IT underscores Infosys' commitment to strengthening its healthcare capabilities, particularly in collaboration with health systems and provider organizations to deliver measurable outcomes across complex clinical and operational environments. Optimum Healthcare IT brings deep provider-domain expertise and a proven delivery model making it a strong strategic fit for Infosys' healthcare growth strategy. This investment significantly enhances Infosys' presence in the provider segment, adding new clients and relationships, expanding technology capabilities, and creating synergies across new buying centers. By bringing together Optimum's provider experience with Infosys Topaz and Infosys Cobalt, we are positioned to create a differentiated value proposition for healthcare providers accelerating end-to-end cloud, data, and digital transformation at scale.

BFINVESTDEEPINDSHCGHCG-REHEALTHCAREINFYMEDANTARSYSTEMSVALUEFinancial ServicesHealthcare
Cement cos in Meghalaya imported nearly 3 lakh mt of coal without valid papers: HC-appointed panel
negative
ET Markets - Industry 69d ago

Cement cos in Meghalaya imported nearly 3 lakh mt of coal without valid papers: HC-appointed panel

Two cement companies in Meghalaya face accusations of violating norms in transporting over 2.93 lakh metric tonnes of coal. A high court-appointed committee reported the companies moved the coal without mandatory approvals. This movement also lacked essential documents and weekly returns. The committee recommended strict enforcement and improved tracking systems to curb illegal coal movement across the state.

COALINDIAJKCEMENTRSYSTEMSConstruction MaterialsInformation Technology