Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:SWELECTESPower
Clear all filters
Five Stocks To Buy On July 3: Coforge, Ather Energy, Persistent Systems, And More
positive
NDTV Profit 8d ago

Five Stocks To Buy On July 3: Coforge, Ather Energy, Persistent Systems, And More

Five Stocks To Buy

ATHERENERGBGRENERGYCOFORGEENERGYGKENERGYKPELPERSISTENTRSYSTEMSSWELECTESAutomobile and Auto ComponentsCapital Goods
Tata Power to install solar, battery energy systems across one lakh households in Punjab over three years
positive
ET Markets - Industry 9d ago

Tata Power to install solar, battery energy systems across one lakh households in Punjab over three years

Tata Power Solaroof has launched 'Ghar Ghar Solar' in Punjab, aiming to equip one lakh households with rooftop solar and battery systems over three years. This initiative, supported by accessible financing and community programs like 'Mera Gaon, Mera Solar', seeks to boost clean energy adoption. The campaign aligns with government subsidies, making solar power more affordable and promoting self-reliant energy solutions across the state.

AFFORDABLEBGRENERGYCLEANCLEANMAXDPELENERGYGKENERGYGVPILKPELMOBIKWIKRSYSTEMSSMARTENSOLARINDSSWELECTESTATAPOWERTATATECHTDPOWERSYSUTLSOLARCapital GoodsChemicals
Sagar Adani urges faster electrification, energy storage
positive
ET Markets - Industry 14d ago

Sagar Adani urges faster electrification, energy storage

Adani was speaking at the inaugural Adani Green Energy Dialogue during London Climate Action Week at the Science Museum. "Renewable energy reaches its full potential when paired with storage technologies such as Battery Energy Storage Systems (BESS) and Pumped Storage Projects (PSPs)," he said.

ADANIENSOLADANIENTADANIGREENBGRENERGYENERGYGKENERGYINOXGREENIREDAKPELKPIGREENNTPCGREENRPPINFRARSYSTEMSSAATVIKGLSWELECTESSWSOLARCapital GoodsConstruction
Kirloskar Oil Engines wins 192 MW power order for AI data centre
positive
CNBC TV18 - Markets 22d ago

Kirloskar Oil Engines wins 192 MW power order for AI data centre

Kirloskar Oil Engines Limited (KOEL) has won a 192 MW power systems order from HyperNext to support a large AI-enabled data centre project in India. The deployment includes 96 units of its Optiprime Dual Core systems, which will provide backup power for hyperscale cloud and AI infrastructure. The project is aimed at building resilient, energy-efficient digital infrastructure to meet rising demand from artificial intelligence and cloud computing workloads.

BGRENERGYDPELENERGYGKENERGYGVPILKIRLOSENGKIRLOSINDKPELOILRSYSTEMSSMARTENSWELECTESTDPOWERSYSUTLSOLARCapital GoodsConstruction
NEWS
positive
Business Standard - Markets 22d ago

KPI Green Energy incorporates WoS named KPCG One

The Company has been incorporated with the object of generating, storing, transmitting, distributing, purchasing, selling and supplying electricity and other forms of energy from conventional and renewable sources, including solar, wind, hydro, biomass and thermal energy, and of establishing, owning, developing, operating and maintaining power plants and energy storage systems, and undertaking activities incidental thereto.

ADANIGREENAGNIBGRENERGYDPELENERGYGKENERGYGREENPOWERGVPILINOXGREENIREDAKPELKPIGREENMOBIKWIKNTPCGREENRSYSTEMSSAATVIKGLSERVOTECHSMARTENSOLARINDSSWELECTESSWSOLARTDPOWERSYSTECILCHEMUTLSOLARCapital GoodsChemicals
NTPC installs 5 GWh battery storage at coal plants in Rs 5,000 crore push to cut renewable curtailment
positive
ET Markets - Industry 23d ago

NTPC installs 5 GWh battery storage at coal plants in Rs 5,000 crore push to cut renewable curtailment

NTPC is installing 5 gigawatt-hours of battery storage at its coal power plants. This initiative aims to reduce renewable energy that goes unused. The investment is around 5,000 crore rupees. These battery systems will absorb excess solar and wind power. The Central Electricity Regulatory Commission has approved a tariff structure for these projects.

BFINVESTBGRENERGYCOALINDIADPELENERGYGKENERGYGVPILIREDAKPELNTPCNTPCGREENPOWERMECHRPPINFRARSYSTEMSSERVOTECHSMARTENSOLARINDSSWELECTESSWSOLARTDPOWERSYSUTLSOLARCapital GoodsChemicals
Centre urges states to accelerate nuclear power plants and green energy storage
positive
ET Markets - Industry 27d ago

Centre urges states to accelerate nuclear power plants and green energy storage

India is accelerating approvals for nuclear power plants and energy storage systems. This push is vital for the nation's growing data and AI centers. States are being urged to speed up clearances for proposed projects. The goal is to ensure a robust energy supply for future power needs. This initiative aims to enhance energy security across the country.

ADANIGREENAGNIBGRENERGYDPELENERGYFELFELDVRGKENERGYGREENPOWERGVPILINOXGREENKPELKPIGREENNTPCGREENPOWERMECHRPPINFRARSYSTEMSSAATVIKGLSMARTENSWELECTESTDPOWERSYSUTLSOLARVITALCapital GoodsChemicals
NEWS
positive
Business Standard - Markets 30d ago

Rane Steering Systems to acquire 26% stake in Hexa Energy BH Eleven

BGRENERGYENERGYGKENERGYKPELRANEHOLDINRSYSTEMSSWELECTESCapital GoodsConstruction
MTAR Tech share price falls 11% as US client faces project uncertainty
positive
Business Standard - Markets 30d ago

MTAR Tech share price falls 11% as US client faces project uncertainty

The sharp decline in MTAR Technologies shares today followed reports that Crusoe Energy Systems LLC has paused work on a project in Wyoming, for which Bloom Energy was contracted as fuel cell supplier

BGRENERGYENERGYGKENERGYKPELMTARTECHRSYSTEMSSWELECTESTECHZTECHCapital GoodsConstruction
NEWS
negative
Business Standard - Markets 36d ago

Jagran Prakashan Ltd leads losers in 'B' group

Suven Life Sciences Ltd, Ravindra Energy Ltd, Sunflag Iron & Steel Company Ltd and Exicom Tele-Systems Ltd are among the other losers in the BSE's 'B' group today, 05 June 2026.

ABSL10BANKALIVUSBGRENERGYBSEBSLSENETFGENERGYEXICOMGKENERGYJAGRANJFLLIFEJFL-REKPELRELTDRPGLIFERSYSTEMSSAILIFESALSTEELSUNFLAGSUVENSWELECTESVRAJCapital GoodsConstruction
Jain Irrigation, Ankur Scientific partner on agri waste-to-energy project in Maharashtra
positive
ET Markets - Industry 36d ago

Jain Irrigation, Ankur Scientific partner on agri waste-to-energy project in Maharashtra

Jain Irrigation Systems Ltd and Ankur Scientific are joining forces for a new project in Jalgaon, Maharashtra. This initiative will convert farm waste into thermal energy and biochar. Farmers will gain an extra income source from their crop residue. The plant will process nearly 50 tonnes of agricultural biomass daily.

BGRENERGYENERGYGKENERGYJISLDVREQSJISLJALEQSKPELPOLYSILRSYSTEMSSWELECTESCapital GoodsConstruction
Energy stock Fujiyama Power Systems hits upper circuit following stock market rebound - Mint
positive
Google News - India Markets 39d ago

Energy stock Fujiyama Power Systems hits upper circuit following stock market rebound - Mint

Energy stock Fujiyama Power Systems hits upper circuit following stock market reboundMint

BGRENERGYDPELENERGYGKENERGYGVPILKPELRSYSTEMSSMARTENSWELECTESTDPOWERSYSUTLSOLARCapital GoodsConstruction