Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:EVINDIAServices
Clear all filters
NEWS
positive
Business Standard - Markets 26d ago

NSE Indices launches 11 new sectoral indices, taking total count to 34

The newly launched indices are Nifty Power, Nifty Capital Goods, Nifty Telecommunications, Nifty Construction, Nifty Consumer Services, Nifty Commercial & Transport Services, Nifty Retail, Nifty Hospitals, Nifty NBFC, Nifty Housing Finance and Nifty Insurance.

AADHARHFCAKCAPITAONETMMQ50AONETOTALAPTUSBAJAJHFLCAPITALSFBCIFLCONSUMERCORALFINACCPCAPECAPINSUREEVIETFEVINDIAGICHSGFINGROWWCAPMGROWWEVGVPILINDOSTARLICHSGFINLTFMOCAPITALPFCPNBHOUSINGRETAILSDREAMSSRGHFLTCITOTALV2RETAILCapital GoodsConsumer Services
No individual data, Sebi to tweak AMC exec pay disclosure norms
positive
ET Markets - Stocks 30d ago

No individual data, Sebi to tweak AMC exec pay disclosure norms

In a bold initiative, the Securities and Exchange Board of India (Sebi) is looking to overhaul the reporting standards for executive compensation within asset management companies (AMCs). Rather than peering into the earnings of individual executives, the new proposal would shift focus to total remuneration for specific roles.

CONSUMERCRAMCEVINDIAFOCUSHDFCAMCICICIAMCNAM-INDIATOTALUTIAMCConsumer DurablesFinancial Services
Mahindra's SUV output dips up to 15% in June amid supply chain worker crunch; XUV 7XO, Thar production hit
positive
ET Markets - Industry 30d ago

Mahindra's SUV output dips up to 15% in June amid supply chain worker crunch; XUV 7XO, Thar production hit

Mahindra & Mahindra is experiencing a significant drop in SUV production. A shortage of contract workers is affecting key parts suppliers. This issue is impacting factory operations for popular models. The automotive industry across India faces similar labor challenges. Companies are adapting through automation and worker retention strategies. Demand for new vehicles remains strong, compounding these production pressures.

BMETRICSEVIETFEVINDIAGROWWEVM&MPVSLTVSSCSAutomobile and Auto ComponentsFinancial Services
Cipla wants new-age medicines to contribute 10% of revenue in five years
positive
CNBC TV18 - Markets 31d ago

Cipla wants new-age medicines to contribute 10% of revenue in five years

Cipla is expanding its innovation ambitions while building manufacturing capacity in the US, as the drugmaker looks to diversify revenue streams and strengthen supply-chain resilience amid increasing regulatory and localisation pressures in global pharmaceutical markets.

BMETRICSCIPLACONSUMEREVIETFEVINDIAGLOBALGROWWEVTVSSCSConsumer ServicesFinancial Services
A new-age thirst for beverages is emerging as a key force in India's consumer goods market
positive
ET Markets - Industry 32d ago

A new-age thirst for beverages is emerging as a key force in India's consumer goods market

Beverage industry in India: Indian companies are seeing strong growth in drinks like coffee, ready-to-drink options, and protein beverages. Younger consumers are driving this trend, seeking convenience and health. Companies are expanding their offerings to meet this demand. This shift presents significant opportunities for future expansion in the Indian beverage market.

CONSUMEREVIETFEVINDIAFELFELDVRFMNLGROWWEVMEDANTAVINCOFEConsumer ServicesFinancial Services
Mirae Asset Sharekhan predicts up to 150% upside in these 3 midcap stocks
positive
Business Standard - Markets 46d ago

Mirae Asset Sharekhan predicts up to 150% upside in these 3 midcap stocks

Midcaps to buy: Muthuselvaraj, Research Analyst at Mirae Asset Sharekhan expects Adani Total Gas to hit ₹1,850 levels; JSW Energy and Astral to rally over 50% as Nifty MidCap hits new life-time high.

ABSLBANETFABSLNN50ETABSLPSEADANIENSOLADANIENTADANIGREENALPHAETFAONETMMQ50AONETOTALASTRALATGLBANKETFBANKPSUBFSIBSLNIFTYCONSUMERDEFENCEDIVIDENDENERGYEQUAL200EQUAL50ESGEVIETFEVINDIAGKENERGYGOLDETFGROWWEVGROWWMC150GSEC10YEARHDFCMID150HEALTHCAREHEALTHYINFRAINTERNETITETFJSWENERGYJSWHLJSWINFRAKPELLICNMID100LIQUIDLIQUIDPLUSLOWVOLMAFANGMAHKTECHMAKEINDIAMASPTOP50METALMID150MID150BEESMID150CASEMIDCAPMIDCAPADDMIDCAPBETAMIDCAPETFMIDCAPIETFMIDQ50ADDMIDSMALLMOENERGYMOMENTUMMULTICAPNAM-INDIANEXT50NIFTYETFNIFTYQLITYOILIETFSBINMID150SELECTIPOSENSEXETFSILVERAGSMALL250SMALLCAPTECHTOP20TOTALVALUECapital GoodsConstruction
Adani turning back the clock: How two group stocks created Rs 1.3 lakh crore wealth in a lopsided Nifty year
positive
ET Markets - Stocks 50d ago

Adani turning back the clock: How two group stocks created Rs 1.3 lakh crore wealth in a lopsided Nifty year

Adani Enterprises and Adani Ports have generated over Rs 1.3 lakh crore in investor wealth this year. These two Adani Group stocks have significantly outperformed the Nifty index. This surge is driven by strong operational performance and renewed investor confidence. Adani Ports shows robust cargo growth and expansion. Adani Enterprises benefits from growth in airports and new industries.

ADANIENTADANIPORTSAONELIQUIDBANKIETFCONSUMEREVIETFEVINDIAGROWWEVHDFCGROWTHHDFCLIQUIDLIQGRWBEESLIQUIDBETFLIQUIDPLUSMOGSECPVTBANIETFSBILIQETFWEALTHFinancial ServicesMetals & Mining
Nifty could hit 27,000 once geopolitical tensions ease: Bajaj Finserv AMC CIO
positive
CNBC TV18 - Markets 53d ago

Nifty could hit 27,000 once geopolitical tensions ease: Bajaj Finserv AMC CIO

Bajaj Finserv AMC CIO Nimesh Chandan projects 15% earnings growth for Nifty in FY28, with EPS rising to the ₹1,420–1,440 range, making valuations look attractive. He backs metals, construction, and cement as long-term plays on a global supply chain shift, holds gold and silver in the multi-asset portfolio, and flags El Niño and elevated US yields as key risks keeping Indian interest rates high in the near term.

ALPHAETFAONELIQUIDBAJAJFINSVBANKBETFBANKETFBANKPSUBFSIBMETRICSBSLGOLDETFCHANDANCONSUMERENERGYESGEVINDIAGENCONGLOBALGOLDETFGSEC10YEARHDFCGROWTHHDFCLIQUIDHEALTHCAREIMFAINFRAINTERNETITETFJKCEMENTLIQGRWBEESLIQUIDLIQUIDBETFLIQUIDPLUSLOWVOLLTGILTBEESMAKEINDIAMETALMIDCAPETFMIDSMALLMULTICAPNEXT50NIFTYBETFNIFTYETFRPPINFRASBILIQETFSILVERSILVERAGSMALL250SMALLCAPTOP20TVSSCSVALUEConstructionConstruction Materials
Stocks in news: JSW Steel, ZEE, Adani Enterprises, Vodafone Idea, Eicher Motors
positive
ET Markets - Stocks 53d ago

Stocks in news: JSW Steel, ZEE, Adani Enterprises, Vodafone Idea, Eicher Motors

Indian markets saw a volatile Monday, ending nearly flat due to global weakness and economic worries. Analysts suggest Nifty is consolidating, with resistance at 23,800-24,000 and support near 23,150-23,300. Key companies like JSW Steel, ZEE, and Adani Enterprises are in focus. IOC reported a significant profit surge. Eicher Motors plans a new manufacturing plant.

ADANIENTADANIPORTSCONSUMEREICHERMOTEVIETFEVINDIAFOCUSGLOBALGROWWCAPMGROWWEVGROWWMC150HDFCMID150IDEAIOCJSWHLJSWINFRAJSWSTEELMAKEINDIAMANUFGBEESMID150MID150BEESMID150CASEMIDCAPADDMIDCAPBETAMIDCAPETFMIDCAPIETFMIDQ50ADDMOMGFSALSTEELSBINMID150Automobile and Auto ComponentsConsumer Durables
Will start introducing India-specific models from 2028, to leverage on 2W biz: Honda Global CEO
positive
ET Markets - Industry 58d ago

Will start introducing India-specific models from 2028, to leverage on 2W biz: Honda Global CEO

Honda plans to launch new car models specifically for India starting in 2028. The company will use its strong motorcycle sales to encourage customers to upgrade to cars. India is a key market for Honda's future growth. Production capacity for two-wheelers will also increase. Honda aims to strengthen its automotive business in India through these strategic moves.

EVIETFEVINDIAFELFELDVRFMNLGLOBALGROWWEVConsumer ServicesFinancial Services
Neo Alternative Asset Managers bets on real estate, ropes in ex-Walton Street India trio to lead charge
positive
ET Markets - Industry 95d ago

Neo Alternative Asset Managers bets on real estate, ropes in ex-Walton Street India trio to lead charge

Neo Alternative Asset Managers is expanding into real estate. The firm has hired a seasoned team from Walton Street India to lead its new investment platform. This move targets structured and opportunistic real estate deals across key Indian urban markets. The expansion aims to leverage India's growing real estate sector, driven by urbanization and infrastructure development.

ABRELBFINVESTCONSUMERESGEVINDIAHUDCOIREDAIVCTRELURBANURBANCOConsumer ServicesFinancial Services
Watch | Sanjay Parekh on where he sees value in banks, IT, cement and telecom stocks
positive
CNBC TV18 - Markets 133d ago

Watch | Sanjay Parekh on where he sees value in banks, IT, cement and telecom stocks

Sohum Asset Managers’ Founder & CIO, Sanjay Parekh, says markets look sluggish despite improving macro conditions, with Q3 Nifty earnings near 8–9%. He sees recovery in CVs (Ashok Leyland), credit growth at ICICI Bank and gradual picka a up in cement and steel. Portfolio stays domestic-focused: overweight telecom, NBFCs, industrials, cement, utilities, ports and logistics; underweight oil & gas and banks, zero FMCG. Watching IT names like Infosys and TCS, mid-cap tech (Persistent, Coforge, Mastek), defence HAL, quick commerce Zomato and Swiggy, and capital goods L&T, JSW Energy.

ABSLBANETFALPHAETFALPL30IETFAONELIQUIDARIHANTCAPASHOKLEYAUTOIETFBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBFSIBFUTILITIEBNKETFAXISCAPITALSFBCASHIETFCOFORGECOMMOIETFCONSUMERCONSUMIETFCPCAPDCCLDEFENCEEBANKNIFTYECAPINSUREENERGYESGEVIETFEVINDIAFINIETFFMCGIETFGKENERGYGROWWCAPMGROWWDEFNCGSEC10IETFGSEC10YEARGSEC5IETFHALHDFCGROWTHHDFCLIQUIDHDFCNIFBANHDFCPSUBKHDFCPVTBANHEALTHCAREHEALTHIETFHPTLICICIAMCICICIBANKINFRAINFRAIETFINFYINTERNETITETFITIETFJKCEMENTJSWCEMENTJSWENERGYJSWHLJSWINFRAJSWSTEELKPELLIQGRWBEESLIQUIDLIQUIDBETFLIQUIDPLUSLOWVOLLOWVOLIETFMAHKTECHMAKEINDIAMASTEKMETALMETALIETFMIDCAPETFMIDCAPIETFMIDSMALLMOCAPITALMODEFENCEMOENERGYMOM30IETFMULTICAPNEXT50NEXT50IETFNIF100IETFNIFTYETFNIFTYIETFNPBETNV20NV20BEESNV20IETFOILOILIETFONGCPERSISTENTPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDQUAL30IETFSALSTEELSBILIQETFSETFNIFBKSJLOGISTICSMALL250SMALLCAPSWIGGYTCSTECHTOP15IETFTOP20VAL30IETFWEALTHZTECHCapital GoodsConstruction