Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:MEDANTA
Clear all filters
Anuh Pharma up 7% on receiving WHO prequalification for anti-malarial API
positive
Business Standard - Markets 68d ago

Anuh Pharma up 7% on receiving WHO prequalification for anti-malarial API

The buying on the counter came after the company received World Health Organization (WHO) prequalification approval for Amodiaquine Hydrochloride USP

ANUHPHRMEDANTAHealthcare
The stock market is back at all-time highs, but worrisome patterns are emerging
negative
CNBC TV18 - Markets 68d ago

The stock market is back at all-time highs, but worrisome patterns are emerging

The equal-weighted S&P 500 gives investors a more accurate look into the overall health of the market – and it’s showing some troubling patterns.

ALLETECALLTIMEMEDANTAConsumer DurablesHealthcare
NEWS
positive
Business Standard - Markets 68d ago

Volumes soar at Niva Bupa Health Insurance Company Ltd counter

Niva Bupa Health Insurance Company Ltd recorded volume of 46.77 lakh shares by 10:47 IST on BSE, a 40.32 times surge over two-week average daily volume of 1.16 lakh shares

BSEECAPINSUREMEDANTANIVABUPASTARHEALTHFinancial ServicesHealthcare
NEWS
positive
Business Standard - Markets 68d ago

Infosys completes acquisition of Optimum Healthcare IT

The acquisition of Optimum Healthcare IT underscores Infosys' commitment to strengthening its healthcare capabilities, particularly in collaboration with health systems and provider organizations to deliver measurable outcomes across complex clinical and operational environments. Optimum Healthcare IT brings deep provider-domain expertise and a proven delivery model making it a strong strategic fit for Infosys' healthcare growth strategy. This investment significantly enhances Infosys' presence in the provider segment, adding new clients and relationships, expanding technology capabilities, and creating synergies across new buying centers. By bringing together Optimum's provider experience with Infosys Topaz and Infosys Cobalt, we are positioned to create a differentiated value proposition for healthcare providers accelerating end-to-end cloud, data, and digital transformation at scale.

BFINVESTDEEPINDSHCGHCG-REHEALTHCAREINFYMEDANTARSYSTEMSVALUEFinancial ServicesHealthcare
Deep Health AI India Limited Board Approves Rights Issue of Up to Rs. 25.00 Crores - scanx.trade
positive
Google News - India Markets 68d ago

Deep Health AI India Limited Board Approves Rights Issue of Up to Rs. 25.00 Crores - scanx.trade

Deep Health AI India Limited Board Approves Rights Issue of Up to Rs. 25.00 Croresscanx.trade

DEEPINDSMEDANTAHealthcareOil Gas & Consumable Fuels
NEWS
neutral
Google News - India Markets 69d ago

Stocks to Watch Today: Maruti Suzuki, Aster DM Health, IndiaMART, RailTel Corporation, ACC, Eveready... - Moneycontrol.com

Stocks to Watch Today: Maruti Suzuki, Aster DM Health, IndiaMART, RailTel Corporation, ACC, Eveready...Moneycontrol.com

ACCEVEREADYINDIAMARTMARUTIMEDANTARAILTELAutomobile and Auto ComponentsConstruction Materials
As mercury soars, e-commerce platforms step up measures to protect delivery workers
positive
ET Markets - Industry 69d ago

As mercury soars, e-commerce platforms step up measures to protect delivery workers

Indian e-commerce and quick-commerce platforms are introducing measures to protect delivery workers from severe heatwaves. Companies are providing cooling gear, air-conditioned rest hubs, and health check-ups. Initiatives include specialized jackets, shaded rest points, and medical support. These efforts aim to safeguard the frontline workforce during the harsh summer months.

MEDANTAHealthcare
Rush to take Rs 1 crore health coveras premiums shed tax load
positive
ET Markets - Industry 72d ago

Rush to take Rs 1 crore health coveras premiums shed tax load

Indians are increasingly opting for health insurance policies of ₹1 crore and above, driven by rising medical costs and greater awareness. Insurers report a significant acceleration in this trend, with customers willing to stretch premiums for higher benefits, especially after GST-related pricing changes made larger covers more accessible.

MEDANTANIVABUPASTARHEALTHTAKEFinancial ServicesHealthcare
PM Modi’s Ujjwala at 10 marks shift from access to empowerment, says education minister Dharmendra Pradhan
positive
ET Markets - Industry 72d ago

PM Modi’s Ujjwala at 10 marks shift from access to empowerment, says education minister Dharmendra Pradhan

Ten years on, the Pradhan Mantri Ujjwala Yojana has provided clean cooking fuel to over 10 crore women. This initiative has significantly improved household health and reduced time spent on fuel collection. Women are now participating more in economic activities, gaining a stronger voice.

CLEANGAUDIUMIVFGLOBALMEDANTAChemicalsConsumer Services
Star Health shares rally 13% after Q4 net profit soars to Rs 111 crore, beats estimate
positive
ET Markets - Stocks 74d ago

Star Health shares rally 13% after Q4 net profit soars to Rs 111 crore, beats estimate

Star Health and Allied Insurance Company's shares surged over 13% after reporting a significant jump in Q4 FY26 net profit to Rs 111.34 crore, exceeding brokerage estimates. The insurer also saw a 14% year-on-year growth in net earned premium and a narrowing of underwriting losses, indicating improved operating efficiency and profitability.

MEDANTAMOGSECNIVABUPAPREMIUMSTARSTARHEALTHAutomobile and Auto ComponentsFinancial Services
Dr Reddy's gets Health Canada nod for generic semaglutide injection
positive
ET Markets - Industry 74d ago

Dr Reddy's gets Health Canada nod for generic semaglutide injection

Dr Reddy's Laboratories has secured market authorization from Health Canada for its generic semaglutide injection. This marks a significant achievement as the first company to receive approval for this diabetes treatment in Canada. The company is now preparing to launch the medication, aiming to provide Canadian patients with access to this important therapy.

DRREDDYMEDANTAHealthcare
Q4 Results: Six stocks seeing the strongest reaction to their quarterly earnings
positive
CNBC TV18 - Markets 74d ago

Q4 Results: Six stocks seeing the strongest reaction to their quarterly earnings

Shares of Garden Reach Shipbuilders Ltd., Bandhan Bank Ltd., Emmvee Photovoltaic Ltd., Star Health Insurance Ltd., CEAT and Canara HSBC Life Insurance Ltd. are six stocks that are seeing the strongest reaction to their fourth quarter results on Wednesday, April 29. The results were reported after market hours on Tuesday. Here's a look at these numbers:

ABSLBANETFBANDHANBNKBANKINDIACANBKCANHLIFECEATLTDEMMVEEGRSEHDFCLIFEICICIPRULILICIMEDANTANIVABUPASBILIFESTARSTARHEALTHAutomobile and Auto ComponentsCapital Goods