Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:Fast Moving Consumer Goods
Clear all filters
ITC bulking up with products rich in protein and fibre: Sanjiv Puri
positive
ET Markets - Industry 18d ago

ITC bulking up with products rich in protein and fibre: Sanjiv Puri

“India is also a protein-deficient market. We already have offerings such as high-protein atta, soya chunks and protein shakes, and we will continue to expand this portfolio,” said Puri, who added that he shed around six kilograms recently and now sticks largely to home-cooked meals, even carrying them on long-haul flights.

ITCFast Moving Consumer Goods
Mamaearth Enters 'Beauty-From-Within' Segment As Parent Honasa Acquires 58% In Nutraceuticals Firm
positive
NDTV Profit 18d ago

Mamaearth Enters 'Beauty-From-Within' Segment As Parent Honasa Acquires 58% In Nutraceuticals Firm

The company will enter the category by establishing a dedicated subsidiary, Honasa Health Pvt.

HONASAMEDANTAFast Moving Consumer GoodsHealthcare
Honasa to acquire 58% stake in nutraceutical company Fluence Pharma
positive
LiveMint - Companies 18d ago

Honasa to acquire 58% stake in nutraceutical company Fluence Pharma

Honasa, which sells brands like Mamaearth and Aqualogica, will acquire the stake in two tranches over the next 5–7 years at a pre-aligned valuation construct

HONASAFast Moving Consumer Goods
Honasa Consumer enters nutraceuticals segment; to acquires 58 pc stake in Fluence Pharma
positive
ET Markets - Industry 18d ago

Honasa Consumer enters nutraceuticals segment; to acquires 58 pc stake in Fluence Pharma

Honasa Consumer, parent of Mamaearth, is acquiring a 58% stake in nutraceuticals firm Fluence Pharma for Rs 135 crore, marking its entry into the health and wellness supplements market. This strategic move aims to leverage Fluence's patented technology and dermatologist network to expand Honasa's 'inside-out' beauty solutions. The acquisition is expected to significantly boost Honasa's growth by diversifying its product portfolio into the rapidly expanding Indian nutraceuticals sector.

CONSUMERHONASAMEDANTAFast Moving Consumer GoodsFinancial Services
Karnataka supports 10,500 food processing units, creates up to 1 lakh jobs: KAPPEC
positive
ET Markets - Industry 18d ago

Karnataka supports 10,500 food processing units, creates up to 1 lakh jobs: KAPPEC

Karnataka is championing micro food processing, supporting over 10,500 units and creating up to one lakh jobs. The state is also a leading millet processing hub. Discussions at a recent conference highlighted the transformative potential of AI and robotics in the agro-food sector, aiming to boost India's processing capabilities from a mere 10% to compete globally. Experts emphasized innovation and technology for value addition and reducing wastage.

BABAFPMVKAGROVALUEFast Moving Consumer GoodsFinancial Services
Stocks to Watch for June 24: Infosys, IRFC, Honasa Consumer, Delhivery and more
positive
CNBC TV18 - Markets 18d ago

Stocks to Watch for June 24: Infosys, IRFC, Honasa Consumer, Delhivery and more

Infosys expands GlobalFoundries AI IT deal, NLC India and IOCL plan green JV, YES Bank, Delhivery, IRFC, Honasa Consumer and Satin Creditcare announce moves. Here are few stocks to track ahead of Wednesday's trading session.

BANKINDIACONSUMERDELHIVERYHONASAINFYIRFCNLCINDIASATINYESBANKFast Moving Consumer GoodsFinancial Services
Honasa Consumer to acquire 58% stake in Fluence Pharma for ₹135 crore
positive
CNBC TV18 - Markets 18d ago

Honasa Consumer to acquire 58% stake in Fluence Pharma for ₹135 crore

Shares of Honasa Consumer Ltd ended at ₹415.90, up by ₹0.85, or 0.20%, on the BSE.

BSECONSUMERHONASAFast Moving Consumer GoodsFinancial Services
Melbourne, Victoria:  Every Bit Different
positive
ET Markets - Industry 18d ago

Melbourne, Victoria: Every Bit Different

Planning a trip to Australia? Explore Melbourne’s famous coffee culture, iconic attractions, art scene, sporting events and scenic coastal experiences in this 2026 travel guide.

COASTCORPFast Moving Consumer Goods
Dabur India Limited schedules 51st AGM for August 6, 2026 - scanx.trade
negative
Google News - India Markets 18d ago

Dabur India Limited schedules 51st AGM for August 6, 2026 - scanx.trade

Dabur India Limited schedules 51st AGM for August 6, 2026scanx.trade

DABURFast Moving Consumer Goods
Dabur India closes trading window from July 1 to July 31, 2026 - scanx.trade
neutral
Google News - India Markets 19d ago

Dabur India closes trading window from July 1 to July 31, 2026 - scanx.trade

Dabur India closes trading window from July 1 to July 31, 2026scanx.trade

DABURFast Moving Consumer Goods
India needs to diversify its sources of energy needs, says NITI vice-chairman
positive
ET Markets - Industry 19d ago

India needs to diversify its sources of energy needs, says NITI vice-chairman

NITI Aayog Vice Chairman Ashok Kumar Lahiri highlighted that the West Asia conflict, though a temporary supply chain issue, underscores India's need to diversify energy sources. He expressed optimism about an upcoming India-US trade agreement and advocated for including pharmaceutical products in future FTAs. Lahiri likened the crisis to a manageable 'influenza,' emphasizing the lesson of not concentrating all import and export dependencies.

ALLETECBMETRICSENERGYFELFELDVRGKENERGYKPELSKMEGGPRODTVSSCSConstructionConsumer Services
NEWS
positive
Business Standard - Markets 19d ago

Dabur India Ltd down for fifth straight session

Dabur India Ltd is quoting at Rs 420.4, down 0.44% on the day as on 13:19 IST on the NSE. The stock tumbled 11.51% in last one year as compared to a 4.48% slide in NIFTY and a 9.61% fall in the Nifty FMCG index.

AONELIQUIDAONENIFTYAONETMMQ50AONETOTALBANKIETFDABURFMCGADDFMCGIETFPVTBANIETFFast Moving Consumer GoodsFinancial Services