Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:KPEL
Clear all filters
NEWS
positive
Business Standard - Markets 16d ago

Bluspring Enterprises bags O&M contract worth Rs 406 crore from Vedanta Power

Bluspring Enterprises said that its wholly-owned step-down subsidiary STEAG Energy Services (India) has received an extension of contract for operations and maintenance of a 600 MW thermal power plant from Vedanta Power.

BLUSPRINGDPELENERGYGKENERGYGVPILKPELVEDLVEDPOWERCapital GoodsConstruction
Anti-dumping duty on electrical steel may push transformer costs, impact grid expansion: GTRI
positive
ET Markets - Industry 16d ago

Anti-dumping duty on electrical steel may push transformer costs, impact grid expansion: GTRI

A potential anti-dumping duty on crucial cold-rolled grain-oriented electrical steel (CRGO) imports could significantly hike transformer manufacturing costs and impede India's ambitious power grid expansion plans. With domestic production meeting less than 10% of demand, imposing duties might raise prices without reducing import reliance, impacting vital infrastructure development and renewable energy integration. The probe follows a complaint by JSW JFE Electrical Steel Nashik Pvt Ltd.

ABHAPOWERDPELENERGYENERGYDEVGKENERGYGVPILIREDAJSWENERGYJSWHLJSWINFRAJSWSTEELKPELMSPLPOWERGRIDQPOWERRELIANCERELINFRARPOWERSALSTEELSERVOTECHSWSOLARVITALCapital GoodsChemicals
NEWS
positive
Business Standard - Markets 16d ago

Clean Max Enviro Energy Solutions allots 41,120 equity shares under ESOS

Consequent to the aforesaid allotment, the paid-up share capital of the Company shall stand increased from Rs 11,71,75,990 to Rs 11,72,17,410.

AKCAPITCLEANCLEANMAXCPCAPENERGYENVIROGKENERGYKPELMAXINDCapital GoodsChemicals
Govt targets solar, hydrogen components to cut import dependence
positive
ET Markets - Industry 16d ago

Govt targets solar, hydrogen components to cut import dependence

India is boosting domestic manufacturing across solar, green hydrogen, and wind energy sectors to curb import reliance. Key focus areas include solar inverters, electrodes, catalysts, bipolar plates, and polysilicon. This strategic move aims to strengthen the supply chain for critical components, addressing current import dependencies and fostering long-term cost competitiveness for India's burgeoning renewable energy industry.

ADANIGREENBMETRICSCURRENTENERGYFOCUSGKENERGYINOXGREENIREDAKPELKPIGREENLTGILTBEESNTPCGREENRELIANCERELINFRASAATVIKGLSOLARINDSSWSOLARTVSSCSCapital GoodsChemicals
Up over 100% since March! Multibagger small-cap stock to be in focus on Monday; here’s why
positive
LiveMint - Markets 16d ago

Up over 100% since March! Multibagger small-cap stock to be in focus on Monday; here’s why

Standard Engineering plans to acquire a 51% stake in GScale Energy for ₹190 crore, marking its entry into AI data-centre infrastructure. The investment is part of a ₹500 crore program focusing on growth and capacity expansion in this emerging market.

BFINVESTENERGYFOCUSGKENERGYHGINFRAKPELMBELSETLSILCapital GoodsConstruction
India, Iran revive energy dialogue as ministers meet on BRICS sidelines
positive
ET Markets - Industry 17d ago

India, Iran revive energy dialogue as ministers meet on BRICS sidelines

India and Iran are exploring new avenues for energy sector collaboration, as announced by Union Minister Hardeep Singh Puri following a meeting with his Iranian counterpart on the sidelines of the BRICS Energy Ministers’ Meeting. This engagement highlights India's ongoing commitment to bolstering its energy security through strategic partnerships with key producing nations. The discussions aimed at fostering mutually beneficial cooperation in the vital energy domain.

ENERGYGKENERGYKPELVITALChemicalsConstruction
Jupiter International Ltd invests Rs 550 cr in new TOPCon solar cell facility in Himachal's Baddi
positive
ET Markets - Industry 17d ago

Jupiter International Ltd invests Rs 550 cr in new TOPCon solar cell facility in Himachal's Baddi

Jupiter International Ltd has boosted its solar cell manufacturing capacity to 3.25 GW with a new 1.25 GW TOPCon unit in Himachal Pradesh, investing Rs 550 crore. This move signifies a shift towards advanced, high-efficiency solar technologies. The company's CEO highlighted this as a key step in their technology journey, paving the way for future expansions and supporting India's clean energy goals.

CLEANCLEANMAXENERGYFELFELDVRGKENERGYKPELSOLARINDSChemicalsConstruction
NEWS
positive
Business Standard - Markets 17d ago

Benchmarks hold their ground despite late profit booking

The benchmark indices ended marginally higher on Thursday, extending gains for a second straight session. The Nifty climbed to a more than one-month high of 24,261.60 around noon, supported by easing crude oil prices and buying in auto and FMCG stocks. However, profit booking in the second half erased most of the intraday gains, while weakness in metal, IT, oil & gas and energy stocks capped the upside. The Nifty still managed to close above the 24,000 mark. Broader markets underperformed, with the midcap and smallcap indices ending in the red.

AONELIQUIDAONENIFTYAONETMMQ50AONETOTALAUTOBEESAUTOIETFENERGYFMCGADDFMCGIETFGILT10BETAGILT5BETAGILT5YBEESGKENERGYGROWWCAPMGROWWMC150GROWWMETALGROWWSC250GSEC10IETFGSEC5IETFHDFCMID150HDFCSML250KPELLICNMID100METALMETALIETFMID150MID150BEESMID150CASEMIDCAPMIDCAPADDMIDCAPBETAMIDCAPETFMIDCAPIETFMIDQ50ADDMOENERGYMOSMALL250OILOILIETFONGCSBINMID150SMALL250SMALLADDSMALLCAPSML100CASEVOGLConstructionFinancial Services
Green Stocks June 25- Green Pack Slips In Weak Market - Saur Energy
negative
Google News - India Markets 17d ago

Green Stocks June 25- Green Pack Slips In Weak Market - Saur Energy

Green Stocks June 25- Green Pack Slips In Weak MarketSaur Energy

ADANIGREENENERGYGKENERGYINOXGREENKPELKPIGREENNTPCGREENSAATVIKGLCapital GoodsConstruction
ONGC, bp sign technical services contract to boost production from Western Offshore Basin
positive
ET Markets - Industry 17d ago

ONGC, bp sign technical services contract to boost production from Western Offshore Basin

ONGC and bp have inked a deal to boost oil and gas output from the Western Offshore Basin. This partnership leverages bp's global expertise to enhance production from India's most prolific hydrocarbon region. The agreement aims to curb production decline, improve recovery rates, and strengthen the nation's energy security, building on successful collaboration at Mumbai High.

ENERGYGKENERGYGLOBALKPELOILOILIETFONGCVOGLConstructionConsumer Services
Sunsol mulls over 2 GW solar deployment through 5k projects in India by 2030
positive
ET Markets - Industry 17d ago

Sunsol mulls over 2 GW solar deployment through 5k projects in India by 2030

Global consultancy Sunkonnect's platform, Sunsol Cleantech, aims to deploy over two gigawatts of solar capacity in India by 2030. This initiative will support 5,000 projects, including rooftop and utility-scale installations, significantly contributing to India's ambitious 280 GW solar target. Sunsol's efforts are crucial for enhancing the nation's energy security, affordability, and sustainability, building on Sunkonnect's extensive experience in renewable energy.

ENERGYGKENERGYGLOBALIREDAKPELRPPINFRASOLARINDSSWSOLARChemicalsConstruction
NEWS
positive
Business Standard - Markets 17d ago

Standard Engg climbs as board nod to acquire majority stake in GScale Energy

Standard Engineering Technology (SETL) jumped 5.11% to Rs 235.65 after the company's board approved the acquisition of up to 51% stake in GScale Energy, marking its strategic entry into the AI datacenter engineering.

ENERGYGKENERGYHGINFRAKPELMBELSETLSILCapital GoodsConstruction