Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:FMNLFinancial Services
Clear all filters
NEWS
positive
Business Standard - Markets 24d ago

JLR plans double digit revenue growth with refocus on North America market

Reiterates existing five-year commitment to invest 18bn in future technologies

FELFELDVRFMNLMOGSECConsumer ServicesFinancial Services
JSW Dulux aims for top 2 position in decorative paints after Akzo buy
positive
ET Markets - Industry 25d ago

JSW Dulux aims for top 2 position in decorative paints after Akzo buy

JSW Dulux is targeting a top-two position in India's paint market. The company plans aggressive expansion and significant investments in its brands and manufacturing. This strategy leverages the JSW Group's strengths to capture future growth opportunities in the expanding Indian market. The Dulux brand will remain central to this ambitious plan.

FELFELDVRFMNLJSWDULUXJSWHLJSWINFRAConsumer DurablesConsumer Services
India's growth story could regain momentum as oil risks fade, say global market strategists
positive
CNBC TV18 - Markets 26d ago

India's growth story could regain momentum as oil risks fade, say global market strategists

Ed Yardeni, President of Yardeni Research and Arvind Sanger, Managing Partner of Geosphere Capital Management discuss the implications of easing geopolitical tensions, India's investment outlook, the future of the AI-driven market rally, emerging-market opportunities and whether elevated US valuations are creating a stronger case for global diversification.

AKCAPITAONETMMQ50ARVINDAVONMOREBFINVESTCPCAPFELFELDVRFMNLGLOBALJAROMOCAPITALMOMENTUMOILConsumer ServicesFinancial Services
‘True test of capitalism’, says billionaire banker Uday Kotak on SpaceX IPO market debut
positive
LiveMint - Markets 27d ago

‘True test of capitalism’, says billionaire banker Uday Kotak on SpaceX IPO market debut

Commenting on the blockbuster debut, Kotak said the company's valuation challenges traditional financial benchmarks and reflects a substantial wager on future growth and innovation.

FELFELDVRFMNLJMFINANCILConsumer ServicesFinancial Services
'Fairy tale or mega bubble?' Uday Kotak says SpaceX IPO valuation does not fit any traditional matrix
neutral
LiveMint - Companies 27d ago

'Fairy tale or mega bubble?' Uday Kotak says SpaceX IPO valuation does not fit any traditional matrix

Uday Kotak, Founder of Kotak Mahindra Bank, described SpaceX's IPO as a significant test of capitalism, highlighting its valuation beyond traditional metrics as a bet on humanity’s future and technological advancement. SpaceX debuted at USD 150, with a market cap of USD 1.77 trillion.

ALPHABANKINDIABANKNIFTY1CHEMICALFELFELDVRFMNLKOTAKBANKLIQUID1MID150M&MMNCMOMENTUM30MSCIINDIANEXT50ETFNIFTY100EWPSUBANKQUALITY30SILVER1Automobile and Auto ComponentsConsumer Services
Tata Play loss widens to Rs 551 crore in FY26 as customers migrate to streaming, DD Free Dish
positive
ET Markets - Industry 28d ago

Tata Play loss widens to Rs 551 crore in FY26 as customers migrate to streaming, DD Free Dish

Tata Play faced a wider net loss and lower revenue in the 2025-26 financial year. Customers are moving away from DTH services to free platforms and streaming services. This trend has impacted Tata Play's subscriber base and market share. A dispute with Sony Pictures Networks India also contributed to the company's challenges. Average revenue per user saw a slight increase.

DISHTVFMNLJMFINANCILTATATECHFinancial ServicesInformation Technology
Uday Kotak calls SpaceX IPO a ‘true test for capitalism’ after stellar market debut
positive
CNBC TV18 - Markets 28d ago

Uday Kotak calls SpaceX IPO a ‘true test for capitalism’ after stellar market debut

Reacting to SpaceX's blockbuster market debut, Kotak said the company's valuation defies conventional financial metrics and represents a massive bet on the future.

FELFELDVRFMNLJMFINANCILConsumer ServicesFinancial Services
Top Gainers & Losers on June 11: Aegis Logistics, DOMS Industries, Tejas Networks, Vodafone Idea among top gainers
negative
LiveMint - Markets 30d ago

Top Gainers & Losers on June 11: Aegis Logistics, DOMS Industries, Tejas Networks, Vodafone Idea among top gainers

The Indian stock market struggled on June 11, with Nifty 50 down 0.24% and Sensex down 0.15%, as tensions in the Middle East escalated after US attacks on Iran, affecting investor sentiment and causing broader market losses.

AEGISLOGAONETMMQ50AONETOTALDOMSFMNLIDEAINFRAMOCAPITALSDL26BEESSJLOGISTICTEJASNETTOP10ADDTOP15IETFTOP20Fast Moving Consumer GoodsFinancial Services
NEWS
negative
Business Standard - Markets 31d ago

INR pares initial losses and settles largely unchanged

The Indian rupee was largely flat and settled almost unchanged at Rs 95.43 per dollar, down just 2 paise on Wednesday, amid likely intervention from the Reserve Bank of India (RBI) to curb excessive volatility and prevent a further slide in the domestic unit. Rupee pared its initial losses as crude oil prices and the US dollar index retreated from their elevated levels. Indian shares gave up early gains to end little changed on Wednesday as investors weighed rising U.S.-Iran tensions and awaited key U.S. inflation data later in the day for fresh insights into market expectations for future interest rates in the face of rising energy-driven inflation risks. The BSE Sensex ended the day at 73,983.18, up by 64.42 points (0.09%), while the NSE Nifty 50 settled at 23,214.95, slipping by 27.15 points (-0.12%).

ABSLBANETFALPL30IETFAONETMMQ50AONETOTALBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBNKETFAXISBSEBSLSENETFGDOLLAREBANKNIFTYENERGYESENSEXFELFELDVRFINIETFFMNLGKENERGYGROWWLOVOLGROWWPSUBKHDFCNIFBANHDFCPSUBKHDFCPVTBANHDFCSENSEXIEXINDIANBIOBIOCIREDAKPELLOWVOLLOWVOL1LOWVOLIETFMOCAPITALMOENERGYMOLOWVOLNEXT30ADDNPBETOILOILIETFPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDSBIBPBSENSEXADDSENSEXAXISSENSEXBETASENSEXETFSENSEXIETFSETFNIFBKSNXT30BEESSNXT50BETASOUTHBANKConstructionConsumer Services
A new-age thirst for beverages is emerging as a key force in India's consumer goods market
positive
ET Markets - Industry 32d ago

A new-age thirst for beverages is emerging as a key force in India's consumer goods market

Beverage industry in India: Indian companies are seeing strong growth in drinks like coffee, ready-to-drink options, and protein beverages. Younger consumers are driving this trend, seeking convenience and health. Companies are expanding their offerings to meet this demand. This shift presents significant opportunities for future expansion in the Indian beverage market.

CONSUMEREVIETFEVINDIAFELFELDVRFMNLGROWWEVMEDANTAVINCOFEConsumer ServicesFinancial Services
Mid and smallcaps get the money as Nifty lags
positive
ET Markets - Stocks 32d ago

Mid and smallcaps get the money as Nifty lags

Investors are increasingly bullish on mid and small-cap stocks, reflecting a notable shift in market sentiment. The Advance-Decline Ratio has shown resilience for the past two months, leading to record highs in midcap and smallcap indices. Meanwhile, large-cap stocks are grappling with foreign selling pressure, suggesting that mid and small caps may continue to shine in the near future.

ADVANCEAONETMMQ50AONETOTALFELFELDVRFMNLGROWWMC150GROWWSC250HDFCMID150HDFCSML250LICNMID100MID150MID150BEESMID150CASEMIDCAPMIDCAPADDMIDCAPBETAMIDCAPETFMIDCAPIETFMIDQ50ADDMOCAPITALMOSMALL250SBINMID150SMALL250SMALLADDSMALLCAPSML100CASEChemicalsConsumer Services
Sensex rises over 200 points, Nifty above 23,400 as investors eye RBI MPC meet outcome
positive
ET Markets - Stocks 36d ago

Sensex rises over 200 points, Nifty above 23,400 as investors eye RBI MPC meet outcome

Indian stock markets are trading higher today. Sensex and Nifty are extending their gains for a second day. Investors are keenly watching the Reserve Bank of India's Monetary Policy Committee meeting. Market analysts expect the RBI to hold interest rates but signal future hikes. This policy decision will influence banking, auto, and real estate sectors.

ABRELABSLBANETFALPHAETFAONETMMQ50AONETOTALAUTOBEESAUTOIETFBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBNKETFAXISEBANKNIFTYFELFELDVRFINIETFFMNLGROWWCAPMGROWWN200GROWWPSUBKHDFCGROWTHHDFCNIFBANHDFCPSUBKHDFCPVTBANINDIANBIOBMOCAPITALMOM30IETFMOMENTUMMOMENTUM30MOMOMENTUMNIFTYQLITYNPBETPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDQUAL30IETFSETFNIFBKSOUTHBANKTRELConsumer ServicesFinancial Services