Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:TVSSCSFinancial Services
Clear all filters
At Sid’s Farm, the pursuit of milk begins with uncompromising standards
positive
ET Markets - Industry 15d ago

At Sid’s Farm, the pursuit of milk begins with uncompromising standards

Sid's Farm is strengthening consumer trust through rigorous daily quality checks and a parent-first approach to dairy production. The company invests over ₹15 lakh every month in antibiotic residue testing while rewarding farmers for maintaining quality standards. Its #HoldUsToIt campaign encourages consumers to question and verify its practices, promoting transparency over traditional brand promises. By aligning supply-chain integrity with food safety, Sid’s Farm aims to set a new benchmark for trust in India's dairy sector.

BMETRICSCONSUMERINTEGRITYTRUSTTVSSCSConstructionFinancial Services
Govt targets solar, hydrogen components to cut import dependence
positive
ET Markets - Industry 16d ago

Govt targets solar, hydrogen components to cut import dependence

India is boosting domestic manufacturing across solar, green hydrogen, and wind energy sectors to curb import reliance. Key focus areas include solar inverters, electrodes, catalysts, bipolar plates, and polysilicon. This strategic move aims to strengthen the supply chain for critical components, addressing current import dependencies and fostering long-term cost competitiveness for India's burgeoning renewable energy industry.

ADANIGREENBMETRICSCURRENTENERGYFOCUSGKENERGYINOXGREENIREDAKPELKPIGREENLTGILTBEESNTPCGREENRELIANCERELINFRASAATVIKGLSOLARINDSSWSOLARTVSSCSCapital GoodsChemicals
United Spirits set to cut 100 jobs to curb costs, streamline operations
positive
ET Markets - Industry 16d ago

United Spirits set to cut 100 jobs to curb costs, streamline operations

United Spirits is cutting around 100 jobs in India as part of parent Diageo's global cost-saving drive. This significant workforce reduction, impacting mid- to senior-level employees, aims to streamline operations and boost productivity. While the company continues investing in key brands and growth markets, further roles could be affected. This move comes despite strong recent financial performance and ongoing supply chain optimization efforts.

BMETRICSGLOBALJMFINANCILTVSSCSUNITDSPRConsumer ServicesFast Moving Consumer Goods
Oil, AI and chips: The new resource race redrawing markets and nations
positive
ET Markets - Industry 18d ago

Oil, AI and chips: The new resource race redrawing markets and nations

The leap to a $5 trillion valuation for Nvidia underscores a dramatic paradigm shift: semiconductors have become the driving force of global economic prowess, akin to oil in previous centuries. With nations such as Taiwan and South Korea emerging through powerhouses like TSMC and Samsung, the future prosperity relies heavily on mastering the semiconductor supply chain as AI technology evolves, reshaping national strength and financial stability.

BMETRICSFELFELDVRGLOBALJMFINANCILOILRACETVSSCSConsumer ServicesFinancial Services
Motilal Oswal initiates coverage on KPR Mill, 7 other textile stocks with up to 43% upside. Own any?
positive
ET Markets - Stocks 18d ago

Motilal Oswal initiates coverage on KPR Mill, 7 other textile stocks with up to 43% upside. Own any?

Motilal Oswal has initiated coverage on eight textile companies, turning bullish on Gokaldas Exports, Indo Count, Arvind Fashions, Pearl Global and Welspun Living. The brokerage expects improving global demand, trade agreements and supply-chain shifts to support India’s textile sector recovery and long-term export growth.

ARVINDARVINDFASNBMETRICSGLOBALGOKEXICILKPRMILLLTGILTBEESMOALPHA50MOBANK10MOCAPITALMODEFENCEMOENERGYMOGOLDMOGSECMOHEALTHMOINFRAMOIPOMOLOWVOLMOM100MOM50MOMENTUM50MOMGFMOMIDMTMMOMNCMOMOMENTUMMON100MON50EQUALMONEXT50MONIFTY100MONIFTY500MONQ50MOPSEMOQUALITYMOREALTYMOSERVICEMOSILVERMOSMALL250MOTILALOFSMOTOURMOVALUEPGILTVSSCSWELCORPWELENTWELSPUNLIVCapital GoodsConstruction
India's pharma supply chain remains 65 per cent dependent on China for critical inputs: NITI Aayog
positive
ET Markets - Industry 18d ago

India's pharma supply chain remains 65 per cent dependent on China for critical inputs: NITI Aayog

India's pharmaceutical sector, despite being the "pharmacy of the world," faces significant reliance on China for raw materials, with nearly 65% of APIs and intermediates sourced from there. NITI Aayog's report highlights supply chain vulnerabilities and calls for moving up the value chain by fostering innovation and industry-academia collaboration. This strategic shift aims to boost high-value product development and capture a larger global market share.

BMETRICSGLOBALRELIANCERELINFRATVSSCSVALUEConsumer ServicesFinancial Services
India needs to diversify its sources of energy needs, says NITI vice-chairman
positive
ET Markets - Industry 18d ago

India needs to diversify its sources of energy needs, says NITI vice-chairman

NITI Aayog Vice Chairman Ashok Kumar Lahiri highlighted that the West Asia conflict, though a temporary supply chain issue, underscores India's need to diversify energy sources. He expressed optimism about an upcoming India-US trade agreement and advocated for including pharmaceutical products in future FTAs. Lahiri likened the crisis to a manageable 'influenza,' emphasizing the lesson of not concentrating all import and export dependencies.

ALLETECBMETRICSENERGYFELFELDVRGKENERGYKPELSKMEGGPRODTVSSCSConstructionConsumer Services
Syrma SGS Technology shares jump 5% after JV pact with Japan’s Kaga Electronics
positive
ET Markets - Stocks 18d ago

Syrma SGS Technology shares jump 5% after JV pact with Japan’s Kaga Electronics

Syrma SGS Technology's shares jumped nearly 5% after announcing a significant joint venture with Japan's Kaga Electronics. This collaboration aims to establish a cutting-edge manufacturing facility in India, primarily serving Japanese clients and bolstering Syrma's presence in high-value electronics. The partnership, with Syrma holding a 60% stake, is seen as a strategic move to capitalize on global supply chain diversification and India's growing appeal for Japanese manufacturing expansion.

BMETRICSGLOBALLGEINDIASYRMATVSSCSVALUECapital GoodsConsumer Durables
ADB Sees India As Biggest Private Sector Market; Targets $1 Billion Direct Support in 2026
positive
NDTV Profit 20d ago

ADB Sees India As Biggest Private Sector Market; Targets $1 Billion Direct Support in 2026

Last month, ADB and Standard Chartered Bank signed agreements to strengthen supply chain finance in India through risk-sharing arrangements covering both US dollar and rupee transactions.

AUBANKBANKINDIABMETRICSCAPITALSFBDOLLAREQUITASBNKESAFSFBJSFBLTFSILSURYODAYTVSSCSUJJIVANSFBUTKARSHBNKFinancial ServicesRealty
Amber Enterprises Ties Up With Oppo To Manufacture Mobile Phones In India
neutral
NDTV Profit 23d ago

Amber Enterprises Ties Up With Oppo To Manufacture Mobile Phones In India

Oppo India's portfolio of brands, including Oppo, OnePlus and Realme, leveraging its manufacturing scale, local supply chain ecosystem and value-addition capabilities.

AMBERBMETRICSTVSSCSVALUEConsumer DurablesFinancial Services
Inflation, supply chain immediate concerns for Indian insurers, says Aon's Joe Peiser
positive
LiveMint - Companies 25d ago

Inflation, supply chain immediate concerns for Indian insurers, says Aon's Joe Peiser

Even as India remains significantly under-insured, recent government measures, such as allowing 100% foreign direct investment (FDI) into the sector, will help bring more insurers into the country, said Joe Peiser, global CEO of risk capital at Aon Insurance Brokers

AKCAPITBFINVESTBMETRICSCPCAPECAPINSUREESGGLOBALTVSSCSConsumer ServicesFinancial Services
China Stock Gauge Sinks as Traders Favor AI Winners Elsewhere
positive
LiveMint - Markets 25d ago

China Stock Gauge Sinks as Traders Favor AI Winners Elsewhere

Chinese stocks listed in Hong Kong are facing bleak milestones as a global rush into artificial intelligence supply chain players sidelines the Internet and consumer companies that dominate the offshore benchmark.

BMETRICSCONSUMERGLOBALINTERNETTVSSCSConsumer ServicesFinancial Services