Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:GLOBALHealthcare
Clear all filters
HDFC Mutual Fund buys additional 10 lakh shares of Global Health for Rs 130 crore
positive
ET Markets - Stocks 16d ago

HDFC Mutual Fund buys additional 10 lakh shares of Global Health for Rs 130 crore

HDFC Mutual Fund has secured an additional 10 lakh shares of Global Health, which is known for operating Medanta hospitals, from co-founder Sunil Sachdeva for Rs 130 crore. This acquisition builds on a prior purchase made last month. The transaction accounts for a 0.37% stake in the company. In related news, Global Health has reported an impressive 39.7% increase in its fourth-quarter profit after tax, totaling Rs 141.7 crore.

ABSLPSEALPHAALPHAETFAONEGOLDAONELIQUIDAONENIFTYAONESILVERAONETOTALAUTOBEESAUTOIETFAXISBPSETFBANK10ADDBANKADDBANKBETFBANKETFBANKPSUBBETF0432BBNPNBETFBBNPPGOLDBFSIBNKETFAXISCHEMICALCHOICEGOLDCOMMOIETFCONSUMAXISDEFENCEDIVIDENDEBANKNIFTYEBBETF0430EBBETF0431EBBETF0433ECAPINSUREEGOLDELIQUIDELM250ENERGYENIFTYEQUAL200EQUAL50EQUAL50ADDESENSEXESGESILVERFINIETFFLEXIADDFMCGADDFMCGIETFGILT10BETAGILT5BETAGLOBALGOLD1GOLD360GOLDADDGOLDAXISGOLDBETAGOLDBNDGOLDETFGROWWCAPMGROWWCHEMGROWWDEFNCGROWWEVGROWWGOLDGROWWHOSPIGROWWLIQIDGROWWLOVOLGROWWMC150GROWWMETALGROWWMOM50GROWWN200GROWWNETGROWWNIFTYGROWWNXT50GROWWPOWERGROWWPSEGROWWPSUBKGROWWRAILGROWWRLTYGROWWSC250GROWWSLVRGSEC10IETFGSEC10YEARHDFCGOLDHDFCGROWTHHDFCLOWVOLHDFCMID150HDFCMOMENTHDFCNEXT50HDFCNIF100HDFCNIFITHDFCPSUBKHDFCPVTBANHDFCQUALHDFCSILVERHDFCSML250HDFCVALUEHEALTHADDHEALTHAXISHEALTHCAREHEALTHIETFHSBCGOLDICICIB22INFRAIETFINTERNETITADDITAXISITBEESITBETAITETFITIETFLICNETFSENLICNMID100LIQGRWBEESLIQUIDLIQUID1LIQUIDPLUSLIQUIDSBILIQUIDSHRILOWVOLMAFANGMAHKTECHMAKEINDIAMANUFGBEESMASPTOP50MEDANTAMETALMETALIETFMID150MIDCAPADDMIDCAPBETAMIDCAPETFMIDCAPIETFMIDQ50ADDMNCMOALPHA50MOBANK10MOCAPITALMODEFENCEMOENERGYMOGOLDMOGSECMOHEALTHMOINFRAMOIPOMOLOWVOLMOM100MOM30IETFMOM50MOMENTUMMOMENTUM30MOMENTUM50MOMGFMOMIDMTMMOMNCMOMOMENTUMMON100MON50EQUALMONEXT50MONIFTY100MONIFTY500MONQ50MOPSEMOQUALITYMOREALTYMOSERVICEMOSILVERMOSMALL250MOTOURMOVALUEMSCIADDMSCIINDIAMULTICAPNEXT30ADDNEXT50NEXT50ADDNEXT50BETANEXT50ETFNEXT50IETFNIFTY100EWNIFTYADDNIFTYAXISNIFTYBETFNIFTYETFNIFTYQLITYOILIETFPHARMABEESPSUBANKADDPSUBNKIETFPVTBANKADDQUALITY30SBIBPBSBIETFCONSBIETFITSBIETFPBSBIETFQLTYSBILIQETFSBINEQWETFSBINMID150SBISILVERSELECTIPOSENSEXAXISSENSEXETFSETF10GILTSILVERSILVER1SILVER360SILVERADDSILVERAGSILVERAXISSILVERBEESSILVERBETASILVERBNDSILVERIETFSMALL250SMALLADDSNXT30BEESTATAGOLDTATSILVTECHTNIDETFTOP10ADDTOP20TWCGOLDETFUNIONGOLDVAL30IETFVALUEVALUEAXISConsumer ServicesFinancial Services
NEWS
positive
Business Standard - Markets 16d ago

Volumes jump at Global Health Ltd counter

Global Health Ltd saw volume of 10.02 lakh shares by 10:46 IST on BSE, a 60.42 fold spurt over two-week average daily volume of 16586 shares

BSEGLOBALMEDANTAConsumer ServicesFinancial Services
India needs innovation at scale to fulfill ambition of becoming global discovery hub: Dr Reddy's
positive
ET Markets - Industry 17d ago

India needs innovation at scale to fulfill ambition of becoming global discovery hub: Dr Reddy's

India must shift from minor advancements to large-scale innovation to become a global discovery hub, according to Dr. Reddy's Laboratories Chairman Satish Reddy. He emphasized the need for robust translational research pathways to ensure scientific breakthroughs benefit patients. The company's white paper highlights that stronger collaboration between academia, industry, and government is crucial for translating research into accessible healthcare solutions and overcoming existing challenges.

DRREDDYGLOBALHCGHCG-REHEALTHCAREJKPAPERNIDANConsumer ServicesFinancial Services
Indian pharma, CDMOs set to gain from US cancer drug supply crunch: Bernstein
positive
CNBC TV18 - Markets 17d ago

Indian pharma, CDMOs set to gain from US cancer drug supply crunch: Bernstein

Zydus Lifesciences, Lupin and Sun Pharmaceutical Industries could benefit from a US oncology drug supply crunch and India's emerging GLP-1 market opportunity, according to Nandan Kulkarni, Senior Analyst-India Healthcare at Bernstein. He believes Indian biopharma companies are strengthening their role in global healthcare supply chains.

GLOBALHCGHCG-REHEALTHCAREHEALTHYLUPINSPARCSUNPHARMAZYDUSLIFEConsumer ServicesFinancial Services
Adani AGM 2026 Live: Gautam Adani Announces Big Workforce, Healthcare And Education Push At AGM
neutral
NDTV Profit 17d ago

Adani AGM 2026 Live: Gautam Adani Announces Big Workforce, Healthcare And Education Push At AGM

Adani AGM 2026 Live: Gautam Adani addresses shareholders today. Track live updates, key announcements, growth plans, capex guidance, debt outlook and major takeaways from the Adani Group AGM.

ADANIENTGLOBALHCGHCG-REHEALTHCAREConsumer ServicesFinancial Services
NEWS
positive
Business Standard - Markets 18d ago

Shilpa Biologicals commissions Antibody-Drug Conjugate (ADC) GMP manufacturing facility

Shilpa Biologicals, a material subsidiary of Shilpa Medicare, announced the commissioning of a state-of-the-art Antibody-Drug Conjugate (ADC) GMP manufacturing facility, purpose-built and designed to meet global regulatory approval standards including US FDA, EMA, and other major health authority requirements. The facility is fully operational, with GMP qualification protocols now actively underway, placing Shilpa on a clear path to commercial readiness.

GLOBALMEDANTASHILPAMEDConsumer ServicesHealthcare
Tech-Led global selloff, Fed rate fears weigh on Indian equities
positive
ET Markets - Stocks 18d ago

Tech-Led global selloff, Fed rate fears weigh on Indian equities

Indian stock markets experienced their sharpest single-day drop in nearly a month, mirroring a global tech sell-off. The Nifty 50 and BSE Sensex both fell significantly, influenced by a strong US dollar and profit-taking after recent gains. While pharma and healthcare sectors showed resilience, most others, including metals and IT, declined. Market volatility increased, with analysts watching key support levels closely.

ALPL30IETFAONELIQUIDAONETMMQ50AONETOTALBSEBSLSENETFGCASHIETFDOLLARECAPINSUREELIQUIDESENSEXGLOBALGROWWCAPMGROWWLIQIDGROWWLOVOLHCGHCG-REHDFCGROWTHHDFCLIQUIDHDFCSENSEXHEALTHADDHEALTHAXISHEALTHCAREHEALTHIETFHEALTHYIMFALIQGRWBEESLIQUIDLIQUID1LIQUIDADDLIQUIDBEESLIQUIDBETFLIQUIDCASELIQUIDETFLIQUIDIETFLIQUIDPLUSLIQUIDSBILIQUIDSHRILOWVOLLOWVOL1LOWVOLIETFMOCAPITALMOHEALTHMOLOWVOLNEXT30ADDPHARMABEESSBILIQETFSENSEXADDSENSEXAXISSENSEXBETASENSEXETFSENSEXIETFSNXT30BEESSNXT50BETATECHZTECHConsumer ServicesFinancial Services
Mcap of 9 most valued firms jumps ₹2.15 trn, Airtel biggest winner
positive
Business Standard - Markets 20d ago

Mcap of 9 most valued firms jumps ₹2.15 trn, Airtel biggest winner

The combined market valuation of nine of the top-10 most valued firms jumped by Rs 2.15 lakh crore last week, with Bharti Airtel emerging as the biggest winner, in line with improving global risk sentiment. Last week, the BSE benchmark Sensex jumped 1,274.95 points, or 1.68 per cent. "Indian equity markets extended their recovery during the week, supported by easing geopolitical concerns, softer crude oil prices, and improving global risk sentiment. Although negotiations remain ongoing and the agreement is yet to be fully implemented, the reduction in geopolitical uncertainty has significantly improved market sentiment," Ponmudi R, CEO - Enrich Money, an online trading and wealth tech firm, said. The market valuation of Bharti Airtel surged by Rs 52,432.67 crore to Rs 11,62,963.30 crore, the most among the top-10 firms. Life Insurance Corporation of India (LIC) added Rs 51,675.23 crore, taking its valuation to Rs 5,56,726.30 crore. The valuation of Bajaj Finance soared by Rs 26,55

ABSL10BANKBAJAJHFLBAJFINANCEBANK10ADDBHARTIARTLBSEBSLSENETFGCANHLIFEECAPINSUREESENSEXGLOBALHDFCLIFEHDFCSENSEXICICIPRULIIOCIRFCJLHLLICHSGFINLICILICNETFSENLTFMOBANK10NEXT30ADDOILSBILIFESENSEXADDSENSEXAXISSENSEXBETASENSEXETFSENSEXIETFSNXT30BEESSNXT50BETATECHWEALTHZTECHConsumer ServicesFinancial Services
Amid Global Uncertainties, Par Panel To Study Evolving Economic Conditions In India
negative
NDTV Profit 20d ago

Amid Global Uncertainties, Par Panel To Study Evolving Economic Conditions In India

According to a Lok Sabha bulletin, the Standing Committee on Finance has chosen 'Evolving Economic Conditions in the Country' as an additional subject for detailed examination during the year 2025-26.

GLOBALLTFPARConsumer ServicesFinancial Services
NEWS
negative
Business Standard - Markets 22d ago

Market snaps five-day rally as IT rout drags Nifty below 24,050

The domestic equity benchmarks ended sharply lower on Friday, snapping a five-session winning streak. The Nifty slipped below the 24,050 mark as a steep sell-off in IT stocks weighed on sentiment. Technology shares came under pressure after Accenture trimmed its revenue growth guidance and flagged weak demand visibility, raising concerns about global IT spending. Healthcare and pharma stocks, however, bucked the broader weakness. Investor sentiment was further affected by continued FII selling, weak global cues and rising geopolitical tensions in the Middle East. Profit booking following the recent market rally also added to the downside pressure.

AONELIQUIDAONETMMQ50AONETOTALGLOBALHCGHCG-REHDFCGROWTHHDFCLIQUIDHEALTHADDHEALTHAXISHEALTHCAREHEALTHIETFHEALTHYLIQGRWBEESLIQUIDBETFLIQUIDPLUSMOCAPITALPHARMABEESSBILIQETFConsumer ServicesFinancial Services
Societe General, Prudential, others buy 3 per cent stake in Anthem Biosciences for Rs 1,275 cr
positive
ET Markets - Industry 22d ago

Societe General, Prudential, others buy 3 per cent stake in Anthem Biosciences for Rs 1,275 cr

Global investors including Societe Generale and Prudential Hong Kong, alongside Indian mutual funds and insurance companies, have bought a 3 percent stake in Anthem Biosciences. The deal, valued at Rs 1,275 crore, saw promoter Aruna Ganesh exit the company. This significant transaction reshapes the promoter's holding in the integrated Contract Research, Development and Manufacturing Organisation.

ANTHEMAUTOIETFCOMMOIETFECAPINSUREFINIETFFMCGIETFGICREGLOBALGODIGITGSEC10IETFHEALTHIETFICICIB22ICICIGIICICIPRULIINFRAIETFIREDAITIETFMAKEINDIAMANUFGBEESMETALIETFMIDCAPIETFMOM30IETFMOMGFNEXT50IETFOILIETFPSUBNKIETFSILVERIETFVAL30IETFConsumer ServicesFinancial Services
EPF Withdrawal Rules 2026: How Much Can You Take Out For Education, Marriage, Home Payout?
positive
NDTV Profit 23d ago

EPF Withdrawal Rules 2026: How Much Can You Take Out For Education, Marriage, Home Payout?

EPF withdrawal rules can help you access funds without taking on debt.

GLOBALTAKEConsumer ServicesHealthcare