Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:INFYOil Gas & Consumable Fuels
Clear all filters
MSCI Rejig: MCX, Indian Bank make the cut; RVNL, Kalyan Jewellers dropped
negative
CNBC TV18 - Markets 59d ago

MSCI Rejig: MCX, Indian Bank make the cut; RVNL, Kalyan Jewellers dropped

On the flip side, HUL, Bajaj Finance, TCS, ONGC, UltraTech, Infosys, HAL, Coal India, Mahindra & Mahindra, Nestle India, Power Grid are among the 75 names whose weightage will see a decline on the MSCI Standard Index.

AUBANKBAJAJHFLBAJFINANCEBANKBETFBANKIETFBANKINDIACAPITALSFBCOALINDIAEQUITASBNKESAFSFBGVPILHALINDIANBINFYIOBIRFCJSFBKALYANKJILKOTAKBANKLTFMCXM&MMSCIINDIANESTLEINDONGCPFCPOWERGRIDPVTBANIETFRVNLSILSOUTHBANKSURYODAYTCSUJJIVANSFBUTKARSHBNKAutomobile and Auto ComponentsCapital Goods
Stock Market Highlights:: Sensex ends over 1,400 points down, goes below 74,500, Nifty50 closes at 23,380 as oil prices soar, rupee weakens to record low - The Times of India
negative
Google News - India Markets 59d ago

Stock Market Highlights:: Sensex ends over 1,400 points down, goes below 74,500, Nifty50 closes at 23,380 as oil prices soar, rupee weakens to record low - The Times of India

Stock Market Highlights:: Sensex ends over 1,400 points down, goes below 74,500, Nifty50 closes at 23,380 as oil prices soar, rupee weakens to record lowThe Times of IndiaSensex Today | Nifty 50 | Stock Market Highlights: Sensex tanks 1,456 pts, Nifty drops below 23,400; rupee ends at record closing lowThe Economic TimesStock Market Highlights, Sensex Today: Investors Lose Rs 11 Lakh Crore As Trump Says 'Ceasefire On Life Support'NDTVSensex crashes 1,500 pts, Nifty ends below 23,400; investors lose ₹11L crore: Key factors behind market fall explainedMintSensex Today Trades Lower | Nifty Below 23,700 | TCS & Infosys Top LosersEquitymasterStock Market Live, May 12: Sensex plunges 1,456 pts, Nifty closes at 23,379, Rupee falls to 95.63/$ on Iran-US deadlockBusinessLineWhy the Indian Stock Market May Be Entering a Long Phase of Low ReturnsThe QuintSensex Today | Stock Market Highlights: Sensex crashes 1,456 points, Nifty ends below 23,400; heavy selloff in midcaps, smallcapsMoneycontrol.comIndia shares lower at close of trade; Nifty 50 down 1.83%Investing.com India

ABSLBANETFABSLNN50ETABSLPSEALPL30IETFAONETMMQ50AONETOTALBSLNIFTYBSLSENETFGGROWWLOVOLGROWWMOM50HEALTHCAREHEALTHYINFYIOCLOWVOLLOWVOL1LOWVOLIETFLTGILTBEESMASPTOP50MOCAPITALMOMENTUMMOMENTUM50MONIFTY500MULTICAPNIFTYQLITYOILOILIETFSDL26BEESTCSTECHTOP10ADDTOP15IETFTOP20VALUEFinancial ServicesInformation Technology
NEWS
positive
Business Standard - Markets 67d ago

Infosys completes acquisition of Optimum Healthcare IT

The acquisition of Optimum Healthcare IT underscores Infosys' commitment to strengthening its healthcare capabilities, particularly in collaboration with health systems and provider organizations to deliver measurable outcomes across complex clinical and operational environments. Optimum Healthcare IT brings deep provider-domain expertise and a proven delivery model making it a strong strategic fit for Infosys' healthcare growth strategy. This investment significantly enhances Infosys' presence in the provider segment, adding new clients and relationships, expanding technology capabilities, and creating synergies across new buying centers. By bringing together Optimum's provider experience with Infosys Topaz and Infosys Cobalt, we are positioned to create a differentiated value proposition for healthcare providers accelerating end-to-end cloud, data, and digital transformation at scale.

BFINVESTDEEPINDSHCGHCG-REHEALTHCAREINFYMEDANTARSYSTEMSVALUEFinancial ServicesHealthcare
Stocks to Watch for April 24: Infosys, Tata Capital, LTM, Adani Energy Solutions, Cyient and more
positive
CNBC TV18 - Markets 78d ago

Stocks to Watch for April 24: Infosys, Tata Capital, LTM, Adani Energy Solutions, Cyient and more

Infosys, LTIMindtree, Tata Capital, Adani Energy Solutions, Cyient, Mahindra Logistics and Himadri Speciality Chemical post mixed Q4, key earnings from Reliance and others due April 24. Here are few stocks to keep an eye on ahead of Friday's trading session.

ADANIENSOLADANIENTADANIGREENAKCAPITCHEMICALCPCAPCYIENTENERGYGKENERGYHSCLINFYKPELLTMMAHLOGM&MPARAGONRELIANCERELINFRASJLOGISTICSPECIALITYTATACAPTATATECHAutomobile and Auto ComponentsChemicals
Top Gainers & Losers on April 22: HCL Tech, Tata Elxsi, Infosys, Bajaj Auto, Nykaa, PTC Industries among top losers
negative
LiveMint - Markets 79d ago

Top Gainers & Losers on April 22: HCL Tech, Tata Elxsi, Infosys, Bajaj Auto, Nykaa, PTC Industries among top losers

The Indian stock market experienced a sell-off on April 22, closing lower as technology stocks plunged. The Nifty 50 fell 0.81%, and S&P BSE Sensex declined 0.95%, with investors wary of US-Iran tensions and fluctuating crude oil prices.

AONETMMQ50AONETOTALAUTOBEESAUTOIETFBAJAJ-AUTOBANK10ADDBANKBETFBSEBSLSENETFGESENSEXHCLTECHHDFCSENSEXINFYIOCLIQUIDBETFMOBANK10MOCAPITALNETFNEXT30ADDNIFTYBETFNPBETNYKAAOILOILIETFPTCPTCILSDL26BEESSENSEXADDSENSEXAXISSENSEXBETASENSEXETFSENSEXIETFSNXT30BEESSNXT50BETATATAELXSITATATECHTECHTNIDETFTOP10ADDTOP15IETFTOP20ZTECHAutomobile and Auto ComponentsCapital Goods
Sensex Today | Stock Market Highlights: Market cap jumps ₹10 lakh crore as Sensex, Nifty rally
positive
CNBC TV18 - Markets 86d ago

Sensex Today | Stock Market Highlights: Market cap jumps ₹10 lakh crore as Sensex, Nifty rally

Sensex Today | Stock Market LIVE Updates: The Sensex surged 1,264 points to close at 78,111, while the Nifty 50 advanced 389 points to settle at 24,231. The rally was led by heavyweights including Reliance Industries Ltd., Larsen & Toubro Ltd., HDFC Bank Ltd. and Infosys Ltd.

ABSLBANETFAONETMMQ50AONETOTALBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBNKETFAXISEBANKNIFTYFINIETFGROWWPSUBKHDFCBANKHDFCGROWTHHDFCLIQUIDHDFCMID150HDFCNEXT50HDFCNIF100HDFCNIFBANHDFCNIFITHDFCNIFTYHDFCPSUBKHDFCPVTBANHDFCSENSEXHDFCSML250INFYLTMOCAPITALNPBETPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDRELIANCERELINFRASETFNIFBKConstructionFinancial Services
8 out of 10 most India's valuable companies add  ₹4.13 lakh crore mcap amid US-Iran ceasefire; HDFC, ICICI Bank top list
positive
LiveMint - Companies 90d ago

8 out of 10 most India's valuable companies add ₹4.13 lakh crore mcap amid US-Iran ceasefire; HDFC, ICICI Bank top list

From the top-10 pack, HDFC Bank, Bharti Airtel, State Bank of India, ICICI Bank, Tata Consultancy Services (TCS), Bajaj Finance, Larsen & Toubro and Hindustan Unilever were the winners, while Reliance Industries and Infosys faced erosion from their valuation.

AUBANKBAJAJHFLBAJFINANCEBANKBETFBANKIETFBANKINDIABHARTIARTLCAPITALSFBEQUITASBNKESAFSFBFINIETFHDFCBANKHDFCNIFBANHDFCPSUBKHDFCPVTBANHINDUNILVRICICIBANKINFYJSFBLTLTFNPBETPSUBNKIETFPVTBANIETFRELIANCERELINFRARHFLSBINSURYODAYTATATECHTCSTOP15IETFUJJIVANSFBUTKARSHBNKConstructionFast Moving Consumer Goods
NEWS
positive
Business Standard - Markets 90d ago

Mcap of 8 top valued firms jumps ₹4.13 trn; HDFC, ICICI Bank top gainers

The combined market valuation of eight of the top-10 most valued firms surged by Rs 4,13,003.23 crore last week, with HDFC Bank and ICICI Bank emerging as the biggest gainers, in tandem with an optimistic trend in equities. Last week, the BSE benchmark Sensex jumped 4,230.7 points or 5.77 per cent, and the NSE Nifty surged 1,337.5 points or 5.88 per cent. "Sentiment remained buoyant amid optimism surrounding a temporary USIran ceasefire, although lingering geopolitical uncertainties capped the pace of gains as the week progressed," Ajit Mishra, SVP, Research, Religare Broking Ltd, said. A sharp decline in crude oil prices below the USD 100 mark eased domestic concerns and triggered a strong rebound across markets, he added. From the top-10 pack, HDFC Bank, Bharti Airtel, State Bank of India, ICICI Bank, Tata Consultancy Services (TCS), Bajaj Finance, Larsen & Toubro and Hindustan Unilever were the winners, while Reliance Industries and Infosys faced erosion from their ...

ABSLBANETFALPL30IETFAONETMMQ50AONETOTALAUBANKAUTOIETFBAJAJHFLBAJFINANCEBANK10ADDBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBHARTIARTLBNKETFAXISBSEBSE500IETFBSLSENETFGCAPITALSFBCASHIETFCOMMOIETFCONSUMIETFEBANKNIFTYECAPINSUREEQUITASBNKESAFSFBESENSEXESGEVIETFFINIETFFMCGIETFGILT10BETAGILT5BETAGILT5YBEESGROWWCAPMGROWWPSUBKGSEC10IETFGSEC5IETFHDFCBANKHDFCBSE500HDFCGROWTHHDFCLIQUIDHDFCMID150HDFCNEXT50HDFCNIF100HDFCNIFBANHDFCNIFITHDFCNIFTYHDFCPSUBKHDFCPVTBANHDFCSENSEXHDFCSML250HEALTHIETFHINDOILEXPHINDUNILVRICICIBANKINFRAIETFINFYITIETFJSFBLICNFNHGPLICNMID100LIQUIDBETFLIQUIDIETFLOWVOLLOWVOL1LOWVOLIETFLTLTFMETALIETFMIDCAPIETFMIDSELIETFMIDSMALLMOBANK10MOCAPITALMOM30IETFMONIFTY100NETFNEXT30ADDNEXT50IETFNIF100BEESNIF100IETFNIFTY100EWNIFTYBETFNIFTYIETFNPBETOILOILIETFPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDQUAL30IETFRELIANCERELIGARERELINFRARHFLSBIBPBSBINSDL26BEESSENSEXADDSENSEXAXISSENSEXBETASENSEXETFSENSEXIETFSETFNIFBKSMALLCAPSML100CASESNXT30BEESSNXT50BETASURYODAYTATATECHTCSTNIDETFTOP100CASETOP10ADDTOP15IETFTOP20UJJIVANSFBUTKARSHBNKConstructionFast Moving Consumer Goods
Stocks to Watch for April 8: Infosys, GAIL, Muthoot Finance, SRF and more
positive
CNBC TV18 - Markets 94d ago

Stocks to Watch for April 8: Infosys, GAIL, Muthoot Finance, SRF and more

From Infosys announcing a strategic collaboration with Harness to GAIL (India) entering into a long-term charter party agreement with Greek shipping firm Alpha Gas, there are some stocks to watch ahead of Wednesday's trading session.

ALPHAGAILINFYLTFLTGILTBEESMUTHOOTFINSCISRFChemicalsFinancial Services
Infosys share price drops 3% to lowest level since April 2023; m-cap slips below  ₹5 lakh crore
neutral
LiveMint - Markets 116d ago

Infosys share price drops 3% to lowest level since April 2023; m-cap slips below ₹5 lakh crore

Infosys shares dropped nearly 3% to ₹1,215, reaching their lowest since April 2023, amid ongoing tech stock sell-offs. The company's market cap fell below ₹5 lakh crore, losing ₹1,72,530 crore in two months, with concerns over rising oil prices and interest rates affecting demand.

ARSSBLINFYOILTECHZTECHFinancial ServicesInformation Technology
Infosys, TCS and other IT stocks rise up to 2% despite weak market mood. What’s driving the resilience?
neutral
ET Markets - Stocks 129d ago

Infosys, TCS and other IT stocks rise up to 2% despite weak market mood. What’s driving the resilience?

Indian IT shares surged on Wednesday, defying a market downturn. Infosys, TCS, and Wipro saw gains of 2.25%. This rebound follows a sharp correction last month. A weaker Rupee and oversold conditions are boosting IT stocks. Meanwhile, global tensions and rising crude oil prices impacted the broader market.

GLOBALINFYIOCOILTCSWIPROConsumer ServicesInformation Technology
Watch | Sanjay Parekh on where he sees value in banks, IT, cement and telecom stocks
positive
CNBC TV18 - Markets 133d ago

Watch | Sanjay Parekh on where he sees value in banks, IT, cement and telecom stocks

Sohum Asset Managers’ Founder & CIO, Sanjay Parekh, says markets look sluggish despite improving macro conditions, with Q3 Nifty earnings near 8–9%. He sees recovery in CVs (Ashok Leyland), credit growth at ICICI Bank and gradual picka a up in cement and steel. Portfolio stays domestic-focused: overweight telecom, NBFCs, industrials, cement, utilities, ports and logistics; underweight oil & gas and banks, zero FMCG. Watching IT names like Infosys and TCS, mid-cap tech (Persistent, Coforge, Mastek), defence HAL, quick commerce Zomato and Swiggy, and capital goods L&T, JSW Energy.

ABSLBANETFALPHAETFALPL30IETFAONELIQUIDARIHANTCAPASHOKLEYAUTOIETFBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBFSIBFUTILITIEBNKETFAXISCAPITALSFBCASHIETFCOFORGECOMMOIETFCONSUMERCONSUMIETFCPCAPDCCLDEFENCEEBANKNIFTYECAPINSUREENERGYESGEVIETFEVINDIAFINIETFFMCGIETFGKENERGYGROWWCAPMGROWWDEFNCGSEC10IETFGSEC10YEARGSEC5IETFHALHDFCGROWTHHDFCLIQUIDHDFCNIFBANHDFCPSUBKHDFCPVTBANHEALTHCAREHEALTHIETFHPTLICICIAMCICICIBANKINFRAINFRAIETFINFYINTERNETITETFITIETFJKCEMENTJSWCEMENTJSWENERGYJSWHLJSWINFRAJSWSTEELKPELLIQGRWBEESLIQUIDLIQUIDBETFLIQUIDPLUSLOWVOLLOWVOLIETFMAHKTECHMAKEINDIAMASTEKMETALMETALIETFMIDCAPETFMIDCAPIETFMIDSMALLMOCAPITALMODEFENCEMOENERGYMOM30IETFMULTICAPNEXT50NEXT50IETFNIF100IETFNIFTYETFNIFTYIETFNPBETNV20NV20BEESNV20IETFOILOILIETFONGCPERSISTENTPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDQUAL30IETFSALSTEELSBILIQETFSETFNIFBKSJLOGISTICSMALL250SMALLCAPSWIGGYTCSTECHTOP15IETFTOP20VAL30IETFWEALTHZTECHCapital GoodsConstruction