Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:PREMIERCapital Goods
Clear all filters
Premier Explosives zooms 52% in 1 month; what's behind the rally?
positive
Business Standard - Markets 22d ago

Premier Explosives zooms 52% in 1 month; what's behind the rally?

In the past six months, the stock price of the company surged 78 per cent, as compared to 10 per cent decline in the BSE Sensex.

BSEBSLSENETFGESENSEXHDFCSENSEXNEXT30ADDPREMEXPLNPREMIERSENSEXADDSENSEXAXISSENSEXBETASENSEXETFSENSEXIETFSNXT30BEESSNXT50BETACapital GoodsChemicals
Buy, Sell Or Hold: Tata Technologies, Titan, Ashok Leyland, Premier Energies, Solar Industries, Time Technoplast — Ask Profit
positive
NDTV Profit 23d ago

Buy, Sell Or Hold: Tata Technologies, Titan, Ashok Leyland, Premier Energies, Solar Industries, Time Technoplast — Ask Profit

Buy Sell Hold

ASHOKLEYPREMIERPREMIERENESOLARINDSTATATECHTIMETECHNOTITANCapital GoodsChemicals
'Expensive' valuations may not necessarily lead to underperformance, Jefferies explains
positive
CNBC TV18 - Markets 23d ago

'Expensive' valuations may not necessarily lead to underperformance, Jefferies explains

Jefferies has highlighted JSW Energy, Adani Energy Solutions, Premier Energies and Siemens Energy as their top picks within the power theme.

ADANIENSOLADANIENTADANIGREENADANIPOWERDPELENERGYENRINGKENERGYGVPILJSWENERGYJSWHLJSWINFRAKPELPREMIERPREMIERENESIEMENSCapital GoodsConstruction
Cloudnine's 25% stake sale attracts top global PE firms
positive
ET Markets - Industry 25d ago

Cloudnine's 25% stake sale attracts top global PE firms

Leading global private equity firms are in the running to acquire a substantial minority stake in Cloudnine, India's premier maternity and paediatric hospital chain. The deal is expected to value the company at approximately $1.2 billion. This strategic move will see existing investor True North exit, while other shareholders are likely to retain their positions.

GLOBALPREMIERVALUECapital GoodsConsumer Services
Iran Vs New Zealand Live Streaming: How To Watch FIFA World Cup 2026 Group G Match On TV, Online?
positive
NDTV Profit 26d ago

Iran Vs New Zealand Live Streaming: How To Watch FIFA World Cup 2026 Group G Match On TV, Online?

Striker Chris Wood is New Zealand's most-known player as he plays in the Premier League for Nottingham Forest.

PREMIERCapital Goods
IPL 2026 becomes most-watched season ever, reaching over 1.2 billion viewers
positive
ET Markets - Industry 26d ago

IPL 2026 becomes most-watched season ever, reaching over 1.2 billion viewers

The 2026 Indian Premier League set a new viewership record. Over 1.2 billion people watched the tournament across television and digital platforms. This marks a significant increase from the previous year. The season finale also drew record numbers. Digital consumption, especially on Connected TV, saw substantial growth. Regional language content also gained popularity.

CONSUMERIPLMOGSECNDTVPREMIERCapital GoodsChemicals
Casagrand Premier Builder's Rs 1,220-Crore IPO Get SEBI's Green Light
positive
NDTV Profit 29d ago

Casagrand Premier Builder's Rs 1,220-Crore IPO Get SEBI's Green Light

The Securities and Exchange Board of India (SEBI) building in Mumbai.

PREMIERCapital Goods
TCS, Anthropic announce global premier partnership for Enterprise AI scaling
neutral
CNBC TV18 - Markets 30d ago

TCS, Anthropic announce global premier partnership for Enterprise AI scaling

TCS will integrate its domain-led engineering expertise—such as capabilities in claims adjudication and lending advisory, into the Claude Code ecosystem through reusable skills and plugins.

GLOBALHGINFRAMBELPREMIERTCSCapital GoodsConstruction
Ruchit Jain of Motilal Oswal suggests Premier Energies, Varun Beverages shares to buy for the short term - Mint
positive
Google News - India Markets 38d ago

Ruchit Jain of Motilal Oswal suggests Premier Energies, Varun Beverages shares to buy for the short term - Mint

Ruchit Jain of Motilal Oswal suggests Premier Energies, Varun Beverages shares to buy for the short termMint

MOALPHA50MOBANK10MOCAPITALMODEFENCEMOENERGYMOGOLDMOGSECMOHEALTHMOINFRAMOIPOMOLOWVOLMOM100MOM50MOMENTUM50MOMGFMOMIDMTMMOMNCMOMOMENTUMMON100MON50EQUALMONEXT50MONIFTY100MONIFTY500MONQ50MOPSEMOQUALITYMOREALTYMOSERVICEMOSILVERMOSMALL250MOTILALOFSMOTOURMOVALUEPREMIERPREMIERENEVBLCapital GoodsFast Moving Consumer Goods
RCB's Rs 400-Crore IPL 2026 Season Underpins Rs 16,660-Crore Valuation After Title Win
positive
NDTV Profit 40d ago

RCB's Rs 400-Crore IPL 2026 Season Underpins Rs 16,660-Crore Valuation After Title Win

Royal Challengers Bengaluru's Virat Kohli arrives to receive an award during the presentation ceremony of Indian Premier League (IPL) 2026 T20 final in Ahmedabad, Gujarat.

IPLPREMIERWEWINCapital GoodsChemicals
RCB Urges Fans To Celebrate At IPL Title Win At Home, Confirms No Victory Parade
positive
NDTV Profit 40d ago

RCB Urges Fans To Celebrate At IPL Title Win At Home, Confirms No Victory Parade

Royal Challengers Bengaluru's players celebrate with the tournament trophy during the presentation ceremony after winning the Indian Premier League (IPL) 2026 title, in Ahmedabad, Gujarat.

IPLPREMIERWEWINCapital GoodsChemicals