Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:FMNLConsumer Services
Clear all filters
JSW Dulux aims for top 2 position in decorative paints after Akzo buy
positive
ET Markets - Industry 24d ago

JSW Dulux aims for top 2 position in decorative paints after Akzo buy

JSW Dulux is targeting a top-two position in India's paint market. The company plans aggressive expansion and significant investments in its brands and manufacturing. This strategy leverages the JSW Group's strengths to capture future growth opportunities in the expanding Indian market. The Dulux brand will remain central to this ambitious plan.

FELFELDVRFMNLJSWDULUXJSWHLJSWINFRAConsumer DurablesConsumer Services
World's top miners BHP, Rio Tinto see India emerging as steel's next growth frontier beyond China
positive
ET Markets - Industry 25d ago

World's top miners BHP, Rio Tinto see India emerging as steel's next growth frontier beyond China

Global mining giants BHP and Rio Tinto are focusing on India for future steel demand. India's rapid urbanisation and infrastructure projects are driving growth. This expansion is expected to offset slowing demand from China. Both companies are well-positioned to support India's ambitious steel production targets. The Global South, particularly India, is becoming a key growth market.

FELFELDVRFMNLGLOBALRPPINFRASALSTEELConstructionConsumer Services
India's growth story could regain momentum as oil risks fade, say global market strategists
positive
CNBC TV18 - Markets 26d ago

India's growth story could regain momentum as oil risks fade, say global market strategists

Ed Yardeni, President of Yardeni Research and Arvind Sanger, Managing Partner of Geosphere Capital Management discuss the implications of easing geopolitical tensions, India's investment outlook, the future of the AI-driven market rally, emerging-market opportunities and whether elevated US valuations are creating a stronger case for global diversification.

AKCAPITAONETMMQ50ARVINDAVONMOREBFINVESTCPCAPFELFELDVRFMNLGLOBALJAROMOCAPITALMOMENTUMOILConsumer ServicesFinancial Services
‘True test of capitalism’, says billionaire banker Uday Kotak on SpaceX IPO market debut
positive
LiveMint - Markets 27d ago

‘True test of capitalism’, says billionaire banker Uday Kotak on SpaceX IPO market debut

Commenting on the blockbuster debut, Kotak said the company's valuation challenges traditional financial benchmarks and reflects a substantial wager on future growth and innovation.

FELFELDVRFMNLJMFINANCILConsumer ServicesFinancial Services
'Fairy tale or mega bubble?' Uday Kotak says SpaceX IPO valuation does not fit any traditional matrix
neutral
LiveMint - Companies 27d ago

'Fairy tale or mega bubble?' Uday Kotak says SpaceX IPO valuation does not fit any traditional matrix

Uday Kotak, Founder of Kotak Mahindra Bank, described SpaceX's IPO as a significant test of capitalism, highlighting its valuation beyond traditional metrics as a bet on humanity’s future and technological advancement. SpaceX debuted at USD 150, with a market cap of USD 1.77 trillion.

ALPHABANKINDIABANKNIFTY1CHEMICALFELFELDVRFMNLKOTAKBANKLIQUID1MID150M&MMNCMOMENTUM30MSCIINDIANEXT50ETFNIFTY100EWPSUBANKQUALITY30SILVER1Automobile and Auto ComponentsConsumer Services
Uday Kotak calls SpaceX IPO a ‘true test for capitalism’ after stellar market debut
positive
CNBC TV18 - Markets 28d ago

Uday Kotak calls SpaceX IPO a ‘true test for capitalism’ after stellar market debut

Reacting to SpaceX's blockbuster market debut, Kotak said the company's valuation defies conventional financial metrics and represents a massive bet on the future.

FELFELDVRFMNLJMFINANCILConsumer ServicesFinancial Services
Humanoid robots and self-driving cars could unlock SpaceX's $28.5 trillion market opportunity: Gwynne Shotwell
positive
CNBC TV18 - Markets 28d ago

Humanoid robots and self-driving cars could unlock SpaceX's $28.5 trillion market opportunity: Gwynne Shotwell

SpaceX is betting that the rapid adoption of autonomous machines and AI-powered systems will drive unprecedented demand for computing power and global connectivity, positioning Starlink at the centre of a future AI ecosystem.

FELFELDVRFMNLGLOBALGVPILRSYSTEMSSMARTENTDPOWERSYSUTLSOLARCapital GoodsConsumer Services
SpaceX IPO Opens Today: Inside The Sci-Fi Vision Of Musk's Multiplanetary Future
positive
NDTV Profit 29d ago

SpaceX IPO Opens Today: Inside The Sci-Fi Vision Of Musk's Multiplanetary Future

Most companies measure success in profits and market share. SpaceX's prospectus introduces a much larger benchmark.

FELFELDVRFMNLSCITVVISIONConsumer ServicesMedia Entertainment & Publication
A home that washes, cools and thinks for you: Inside LG's 'Zero Labor Home' vision for India
positive
ET Markets - Industry 30d ago

A home that washes, cools and thinks for you: Inside LG's 'Zero Labor Home' vision for India

LG Electronics is building a future home powered by artificial intelligence. Intelligent appliances, connected platforms, and robots will work together to automate chores. This "Zero Labor Home" vision aims for ultimate convenience. India is a key market for these advanced AI-driven living solutions. LG's manufacturing facilities are aligning with this global AI roadmap.

FELFELDVRFMNLGLOBALLGEINDIATVVISIONConsumer DurablesConsumer Services
NEWS
negative
Business Standard - Markets 31d ago

INR pares initial losses and settles largely unchanged

The Indian rupee was largely flat and settled almost unchanged at Rs 95.43 per dollar, down just 2 paise on Wednesday, amid likely intervention from the Reserve Bank of India (RBI) to curb excessive volatility and prevent a further slide in the domestic unit. Rupee pared its initial losses as crude oil prices and the US dollar index retreated from their elevated levels. Indian shares gave up early gains to end little changed on Wednesday as investors weighed rising U.S.-Iran tensions and awaited key U.S. inflation data later in the day for fresh insights into market expectations for future interest rates in the face of rising energy-driven inflation risks. The BSE Sensex ended the day at 73,983.18, up by 64.42 points (0.09%), while the NSE Nifty 50 settled at 23,214.95, slipping by 27.15 points (-0.12%).

ABSLBANETFALPL30IETFAONETMMQ50AONETOTALBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBNKETFAXISBSEBSLSENETFGDOLLAREBANKNIFTYENERGYESENSEXFELFELDVRFINIETFFMNLGKENERGYGROWWLOVOLGROWWPSUBKHDFCNIFBANHDFCPSUBKHDFCPVTBANHDFCSENSEXIEXINDIANBIOBIOCIREDAKPELLOWVOLLOWVOL1LOWVOLIETFMOCAPITALMOENERGYMOLOWVOLNEXT30ADDNPBETOILOILIETFPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDSBIBPBSENSEXADDSENSEXAXISSENSEXBETASENSEXETFSENSEXIETFSETFNIFBKSNXT30BEESSNXT50BETASOUTHBANKConstructionConsumer Services
Sebi eyes market making framework for commodity derivatives to improve liquidity
positive
LiveMint - Markets 32d ago

Sebi eyes market making framework for commodity derivatives to improve liquidity

Sebi is considering a market-making framework to boost liquidity in longer-dated commodity derivatives, helping businesses hedge future price risks more effectively. The move aims to reduce dependence on near-expiry contracts, improve price discovery and deepen India's commodity markets.

FELFELDVRFMNLConsumer ServicesServices
A new-age thirst for beverages is emerging as a key force in India's consumer goods market
positive
ET Markets - Industry 32d ago

A new-age thirst for beverages is emerging as a key force in India's consumer goods market

Beverage industry in India: Indian companies are seeing strong growth in drinks like coffee, ready-to-drink options, and protein beverages. Younger consumers are driving this trend, seeking convenience and health. Companies are expanding their offerings to meet this demand. This shift presents significant opportunities for future expansion in the Indian beverage market.

CONSUMEREVIETFEVINDIAFELFELDVRFMNLGROWWEVMEDANTAVINCOFEConsumer ServicesFinancial Services