Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:HCGInformation Technology
Clear all filters
Hexaware Tech reiterates revenue, margin guidance for 2026; Stock declines after Q1
positive
CNBC TV18 - Markets 65d ago

Hexaware Tech reiterates revenue, margin guidance for 2026; Stock declines after Q1

Hexaware Tech's healthcare and insurance vertical was the clear standout as it contributed to 22.6% of its revenue. The segment saw growth of 9.8% sequentially and 13.5% from the previous year.

HCGHCG-REHEALTHCAREHEXTMOGSECTECHZTECHFinancial ServicesHealthcare
NEWS
positive
Business Standard - Markets 67d ago

Infosys completes acquisition of Optimum Healthcare IT

The acquisition of Optimum Healthcare IT underscores Infosys' commitment to strengthening its healthcare capabilities, particularly in collaboration with health systems and provider organizations to deliver measurable outcomes across complex clinical and operational environments. Optimum Healthcare IT brings deep provider-domain expertise and a proven delivery model making it a strong strategic fit for Infosys' healthcare growth strategy. This investment significantly enhances Infosys' presence in the provider segment, adding new clients and relationships, expanding technology capabilities, and creating synergies across new buying centers. By bringing together Optimum's provider experience with Infosys Topaz and Infosys Cobalt, we are positioned to create a differentiated value proposition for healthcare providers accelerating end-to-end cloud, data, and digital transformation at scale.

BFINVESTDEEPINDSHCGHCG-REHEALTHCAREINFYMEDANTARSYSTEMSVALUEFinancial ServicesHealthcare
NEWS
positive
Business Standard - Markets 78d ago

IKS announces acquisition of Nasdaq-listed TruBridge Inc.

Inventurus Knowledge Solutions, Inc. (IKS), the U.S. subsidiary of Inventurus Knowledge Solutions (IKS Health), announced it has entered into a definitive agreement to acquire TruBridge, Inc. (NASDAQ: TBRG) (TruBridge), a prominent provider of healthcare technology solutions for rural and community hospitals. This proposed strategic acquisition underscores a commitment to broaden access to high-quality care and support the clinicians and hospitals that serve communities across the United States.

AGARWALEYEAMRUTANJANHCGHCG-REHEALTHCAREIKSMEDANTAPGHHZOTAFast Moving Consumer GoodsFinancial Services
NEWS
negative
Business Standard - Markets 79d ago

Sensex dives 850 pts, Nifty slips below 24,200 amid oil shock and weak global cues

The equity benchmark indices Sensex and Nifty tumbled on Thursday, extending losses for a second straight session. Firm crude oil prices and ongoing geopolitical tensions rattled sentiment. Brent crude surged for the fourth consecutive day to around $103 per barrel amid uncertainty over US-Iran talks and fresh concerns around the Strait of Hormuz. Weak Asian cues and persistent foreign fund outflows deepened the sell-off. The Nifty slipped below the 24,200 mark, dragged by auto, PSU banks and consumer durables stocks, while pharma and healthcare shares saw selective buying. Investors stayed cautious, closely tracking the ongoing Q4 earnings season for further triggers.

ABSLPSEALPHAALPHAETFAONELIQUIDAONENIFTYAONETOTALAUTOBEESAUTOIETFAXISBPSETFBANK10ADDBANKADDBANKBETFBANKETFBANKPSUBBNPNBETFBFSIBNKETFAXISCHEMICALCOMMOIETFCONSUMAXISCONSUMEREBANKNIFTYELIQUIDELM250ENERGYENIFTYEQUAL200EQUAL50ADDESENSEXESGFINIETFFMCGIETFGILT10BETAGILT5BETAGILT5YBEESGLOBALGROWWCAPMGROWWCHEMGROWWDEFNCGROWWEVGROWWLIQIDGROWWLOVOLGROWWMC150GROWWMETALGROWWMOM50GROWWN200GROWWNETGROWWNIFTYGROWWNXT50GROWWPSEGROWWPSUBKGROWWRAILGROWWRLTYGROWWSC250GSEC10IETFGSEC10YEARGSEC5IETFHCGHCG-REHDFCGROWTHHDFCMID150HDFCNEXT50HDFCNIF100HDFCNIFITHDFCPSUBKHDFCPVTBANHDFCSML250HEALTHADDHEALTHAXISHEALTHCAREHEALTHIETFHEALTHYINFRAIETFINTERNETITADDITAXISITBEESITBETAITETFITIETFIVZINNIFTYLICNETFN50LICNETFSENLICNMID100LIQGRWBEESLIQUIDLIQUID1LIQUIDCASELIQUIDPLUSLIQUIDSBILIQUIDSHRILOWVOLLTGILTCASEMAKEINDIAMANUFGBEESMETALMETALIETFMID150MID150CASEMIDCAPADDMIDCAPBETAMIDCAPETFMIDCAPIETFMIDQ50ADDMNCMOALPHA50MOBANK10MOCAPITALMODEFENCEMOENERGYMOHEALTHMOM30IETFMOMENTUMMOMENTUM30MOMENTUM50MOMGFMOMIDMTMMOMNCMOMOMENTUMMON50EQUALMONEXT50MONIFTY100MONIFTY500MOPSEMOREALTYMOSERVICEMOSMALL250MOTOURMULTICAPNETFNEXT30ADDNEXT50NEXT50ADDNEXT50BETANEXT50ETFNEXT50IETFNIFTY100EWNIFTYADDNIFTYAXISNIFTYBETFNIFTYCASENIFTYETFNIFTYQLITYNPBETOILOILIETFPERSISTENTPHARMABEESPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANKADDQUAL30IETFSANOFICONRSBIBPBSBILIQETFSBINMID150SENSEXAXISSENSEXETFSMALL250SMALLADDSML100CASESNXT30BEESTECHTNIDETFTOP100CASETOP10ADDTOP20VALUEConsumer ServicesFinancial Services
'Weak and lacklustre': Why Jefferies is disappointed with Wipro earnings as ADRs fall nearly 3%
negative
ET Markets - Stocks 85d ago

'Weak and lacklustre': Why Jefferies is disappointed with Wipro earnings as ADRs fall nearly 3%

Wipro’s March quarter results missed expectations, with weak revenue growth, declining profit, and soft guidance. Jefferies highlighted slowing deal momentum, weakness in BFSI and healthcare, and client-specific declines, raising concerns over near-term growth despite stable margins and a buyback announcement.

BFSIHCGHCG-REHEALTHCAREMOMENTUMWIPROFinancial ServicesHealthcare
Wipro Q4 Preview: Profit may fall on margin pressures. Is buyback the only thing to cheer?
negative
ET Markets - Stocks 87d ago

Wipro Q4 Preview: Profit may fall on margin pressures. Is buyback the only thing to cheer?

Wipro is expected to report steady revenue growth but weaker profitability in the March quarter, impacted by wage hikes, acquisition-related costs and subdued discretionary spending. Sequential growth remains muted despite acquisition support, while BFSI shows resilience, and healthcare remains weak. Investors will closely track margins, deal pipeline and AI outlook.

BFSIHCGHCG-REHEALTHCAREWIPROFinancial ServicesHealthcare
Jhunjhunwalas-backed IKS healthcare looks to acquire TruBridge for $600 million
positive
ET Markets - Industry 89d ago

Jhunjhunwalas-backed IKS healthcare looks to acquire TruBridge for $600 million

Nasdaq-listed company will be largest buyout for tech company till date. Will give boost for revenue cycle management offerings.

HCGHCG-REHEALTHCAREIKSTECHZTECHFinancial ServicesHealthcare
Tata Elxsi sets up offshore tech centre in Pune for AI-driven healthcare solutions
positive
CNBC TV18 - Markets 114d ago

Tata Elxsi sets up offshore tech centre in Pune for AI-driven healthcare solutions

Tata Elxsi launched a global offshore development centre for Tokyo-based Terumo Corporation to enhance cardiac and vascular solutions using AI and GenAI. Shares of Tata Elxsi ended lower on Thursday, March 19, by 4% at ₹4,039.30 on the NSE.

GLOBALHCGHCG-REHEALTHCARETATAELXSITATATECHTECHZTECHConsumer ServicesFinancial Services
Shriram General Insurance launches 'Shri Health Suraksha 2.0'
positive
ET Markets - Industry 119d ago

Shriram General Insurance launches 'Shri Health Suraksha 2.0'

In response to evolving healthcare needs, Shriram General Insurance Company announced the launch of Shri Health Suraksha 2.0, an enhanced health insurance suite engineered for greater flexibility and 'all-inclusive' protection. This indemnity plan addresses critical gaps in traditional coverage by removing standard caps on room charges and adding unlimited restoration benefits.

ALLETECGICREGODIGITHCGHCG-REHEALTHCAREICICIGIMEDANTANIVABUPASILSTARHEALTHSURAKSHAFinancial ServicesHealthcare
NEWS
positive
Business Standard - Markets 124d ago

Sensex crash over 2,235 in early trade; VIX surges 20.82%

The Nifty traded below the 23,750 mark. All sectoral indices on the NSE were traded in the red, with PSU bank, auto and healthcare shares declining the most.

ABSLBANETFALLETECAUTOBEESAUTOIETFBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBNKETFAXISEBANKNIFTYFINIETFGROWWRAILHCGHDFCNIFBANHDFCPSUBKHDFCPVTBANHEALTHADDHEALTHAXISHEALTHCAREHEALTHIETFHEALTHYIVZINNIFTYLICNETFN50LICNETFSENMIDCAPBETANETFNEXT50BETANPBETPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDSBIBPBSETFNIFBKTNIDETFFinancial ServicesHealthcare
Stock market today: Trade setup for Nifty 50, Gift Nifty, US-Iran war to gold, silver rates — 7 stocks to buy or sell
neutral
LiveMint - Markets 141d ago

Stock market today: Trade setup for Nifty 50, Gift Nifty, US-Iran war to gold, silver rates — 7 stocks to buy or sell

Stocks to buy today: Experts have recommended buying these eight shares — UPL, Biocon, HDFC Life, Fortis Healthcare, Tata Technologies, Samman Capital, and MM Forging

ABSLBANETFABSLNN50ETABSLPSEAONETMMQ50AONETOTALBIOCONBSLGOLDETFBSLNIFTYCPCAPFORTISGROWWCAPMHCGHDFCGOLDHDFCGROWTHHDFCLIFEHDFCLIQUIDHDFCMID150HDFCNEXT50HDFCNIF100HDFCNIFBANHDFCNIFITHDFCNIFTYHDFCPSUBKHDFCPVTBANHDFCSILVERHDFCSML250HEALTHADDHEALTHAXISHEALTHCAREHEALTHIETFHEALTHYMOCAPITALMOMENTUMNETFNIFTYQLITYNPBETSILVERTATACAPTATAGOLDTATATECHTATSILVTECHTNIDETFUPLChemicalsFinancial Services
Taking Stock: Nifty ends above 24,200, Sensex up 1,264 points; all sectors rally
positive
Moneycontrol NaNd ago

Taking Stock: Nifty ends above 24,200, Sensex up 1,264 points; all sectors rally

Interglobe Aviation, Max Healthcare, Power Grid Corp, Wipro, Eternal were among biggest gainers on the Nifty, while losers were Dr Reddy's Laboratories, Bharti Airtel, ICICI Bank.

ABSLBANETFALLETECALPHAETFALPL30IETFAUTOIETFBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBHARTIARTLBNKETFAXISCOMMOIETFCONSUMIETFDRREDDYEBANKNIFTYETERNALEVIETFFINIETFFMCGIETFGROWWN200GROWWPSUBKGSEC10IETFGSEC5IETFGVPILHCGHCG-REHDFCGROWTHHDFCNIFBANHDFCPSUBKHDFCPVTBANHEALTHADDHEALTHAXISHEALTHCAREHEALTHIETFHEALTHYICICIBANKINDIGOINFRAIETFITIETFLOWVOLIETFMAXHEALTHMAXINDMETALIETFMIDCAPIETFMOM30IETFMOMENTUMMOMENTUM30MOMOMENTUMNEXT50IETFNIDANNIF100IETFNIFTYIETFNIFTYQLITYNPBETOILIETFPOWERGRIDPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDQUAL30IETFSENSEXIETFSETFNIFBKTOP15IETFWIPROCapital GoodsConsumer Services