Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:LTMInformation Technology
Clear all filters
LTM aims to double revenue to $10 billion by FY31, bets big on AI-led deals
positive
LiveMint - Companies 63d ago

LTM aims to double revenue to $10 billion by FY31, bets big on AI-led deals

The Mumbai-based company ended last year with $4.76 billion in revenue, up 6%. More than a third of this growth came from manufacturing and resources companies, which make up about a fifth of its revenue. Two years ago, LTM had outlined a goal to touch $10 billion revenue by FY32.

LTMMOGSECFinancial ServicesInformation Technology
LTIMindtree Share Price Live Updates: Market stability indicated by LTIMindtree's beta
positive
ET Markets - Stocks 65d ago

LTIMindtree Share Price Live Updates: Market stability indicated by LTIMindtree's beta

BETALTMHealthcareInformation Technology
NEWS
positive
Business Standard - Markets 67d ago

Uniphore and LTM announce strategic partnership

To co-develop industry- and domain-specific AI solutions

LTMInformation Technology
Q4 Results LIVE Updates: UTI AMC profit drops 73%; IEX operating profit up 23%
positive
CNBC TV18 - Markets 78d ago

Q4 Results LIVE Updates: UTI AMC profit drops 73%; IEX operating profit up 23%

Q4 Results LIVE Updates: Infosys, LTIMindtree, IEX, Union Bank of India, Aditya Birla Sun Life AMC, Adani Energy Solutions, CIE India, Bluestone Jewellery, Mahindra Logistics, Tata Capital, Sterling & Wilson Renewables, Tata Teleservices (Maharashtra), and UTI AMC are among the important earnings to track today. The street will react to results reported by Trent, BCCL, and other companies as well. Watch this space for all the LIVE updates.

ABCAPITALABFRLABGSECABLBLABRELABSLAMCABSLBANETFABSLLIQUIDABSLNN50ETABSLPSEADANIENSOLADANIENTADANIGREENAKCAPITALLETECBANKBETABANKINDIABIRLACORPNBIRLAMONEYBLUESTONEBSLGOLDETFBSLNIFTYBSLSENETFGCAPITALSFBCPCAPCUBENERGYGKENERGYGSEC10ABSLHEALTHYIEXINFYKOTAKBANKKPELLTMMAHABANKMAHLOGM&MMOMENTUMNIFTYQLITYNPBETSILVERSJLOGISTICSWSOLARTATACAPTATATECHTECHTRENTTTMLUNIONBANKAutomobile and Auto ComponentsConstruction
Stocks to Watch for April 24: Infosys, Tata Capital, LTM, Adani Energy Solutions, Cyient and more
positive
CNBC TV18 - Markets 78d ago

Stocks to Watch for April 24: Infosys, Tata Capital, LTM, Adani Energy Solutions, Cyient and more

Infosys, LTIMindtree, Tata Capital, Adani Energy Solutions, Cyient, Mahindra Logistics and Himadri Speciality Chemical post mixed Q4, key earnings from Reliance and others due April 24. Here are few stocks to keep an eye on ahead of Friday's trading session.

ADANIENSOLADANIENTADANIGREENAKCAPITCHEMICALCPCAPCYIENTENERGYGKENERGYHSCLINFYKPELLTMMAHLOGM&MPARAGONRELIANCERELINFRASJLOGISTICSPECIALITYTATACAPTATATECHAutomobile and Auto ComponentsChemicals
Infosys Q4 results 2026: Headcount falls by 8,400 even as operating profits jump 13.6% YoY
positive
LiveMint - Companies 78d ago

Infosys Q4 results 2026: Headcount falls by 8,400 even as operating profits jump 13.6% YoY

The IT giant’s last twelve-month (LTM) attrition rate has increased from 12.3% in Q3 to 12.6% in Q4 of FY26.

INFYLTMInformation Technology
LTM Q4 results: Profit jumps 45% sequentially, margins contract; dividend declared
positive
CNBC TV18 - Markets 78d ago

LTM Q4 results: Profit jumps 45% sequentially, margins contract; dividend declared

LTM Q4 revenue rose 4.7% to ₹11,291.7 crore, net profit jumped 44.6% to ₹1,387 crore, margins fell, board proposed ₹53 dividend per share.

DIVIDENDLTMFinancial ServicesInformation Technology
LTIMindtree Share Price Highlights: LTIMindtree Stock Price History
positive
ET Markets - Stocks 79d ago

LTIMindtree Share Price Highlights: LTIMindtree Stock Price History

ARSSBLLTMFinancial ServicesInformation Technology
What Anthropic’s powerful new model means for Indian IT stocks
neutral
LiveMint - Markets 87d ago

What Anthropic’s powerful new model means for Indian IT stocks

Infosys, Tata Consultancy Services (TCS), LTIMindtree, Coforge, Wipro, and L&T Technology Services are among the major IT players that have all fallen more than 20% on a year-to-date (YTD) basis.

ALLETECCOFORGEINFYLTMTATATECHTCSWIPROInformation Technology