Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:FMNLServices
Clear all filters
Top Gainers & Losers on June 11: Aegis Logistics, DOMS Industries, Tejas Networks, Vodafone Idea among top gainers
negative
LiveMint - Markets 30d ago

Top Gainers & Losers on June 11: Aegis Logistics, DOMS Industries, Tejas Networks, Vodafone Idea among top gainers

The Indian stock market struggled on June 11, with Nifty 50 down 0.24% and Sensex down 0.15%, as tensions in the Middle East escalated after US attacks on Iran, affecting investor sentiment and causing broader market losses.

AEGISLOGAONETMMQ50AONETOTALDOMSFMNLIDEAINFRAMOCAPITALSDL26BEESSJLOGISTICTEJASNETTOP10ADDTOP15IETFTOP20Fast Moving Consumer GoodsFinancial Services
A home that washes, cools and thinks for you: Inside LG's 'Zero Labor Home' vision for India
positive
ET Markets - Industry 30d ago

A home that washes, cools and thinks for you: Inside LG's 'Zero Labor Home' vision for India

LG Electronics is building a future home powered by artificial intelligence. Intelligent appliances, connected platforms, and robots will work together to automate chores. This "Zero Labor Home" vision aims for ultimate convenience. India is a key market for these advanced AI-driven living solutions. LG's manufacturing facilities are aligning with this global AI roadmap.

FELFELDVRFMNLGLOBALLGEINDIATVVISIONConsumer DurablesConsumer Services
NEWS
negative
Business Standard - Markets 31d ago

INR pares initial losses and settles largely unchanged

The Indian rupee was largely flat and settled almost unchanged at Rs 95.43 per dollar, down just 2 paise on Wednesday, amid likely intervention from the Reserve Bank of India (RBI) to curb excessive volatility and prevent a further slide in the domestic unit. Rupee pared its initial losses as crude oil prices and the US dollar index retreated from their elevated levels. Indian shares gave up early gains to end little changed on Wednesday as investors weighed rising U.S.-Iran tensions and awaited key U.S. inflation data later in the day for fresh insights into market expectations for future interest rates in the face of rising energy-driven inflation risks. The BSE Sensex ended the day at 73,983.18, up by 64.42 points (0.09%), while the NSE Nifty 50 settled at 23,214.95, slipping by 27.15 points (-0.12%).

ABSLBANETFALPL30IETFAONETMMQ50AONETOTALBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBNKETFAXISBSEBSLSENETFGDOLLAREBANKNIFTYENERGYESENSEXFELFELDVRFINIETFFMNLGKENERGYGROWWLOVOLGROWWPSUBKHDFCNIFBANHDFCPSUBKHDFCPVTBANHDFCSENSEXIEXINDIANBIOBIOCIREDAKPELLOWVOLLOWVOL1LOWVOLIETFMOCAPITALMOENERGYMOLOWVOLNEXT30ADDNPBETOILOILIETFPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDSBIBPBSENSEXADDSENSEXAXISSENSEXBETASENSEXETFSENSEXIETFSETFNIFBKSNXT30BEESSNXT50BETASOUTHBANKConstructionConsumer Services
Sebi eyes market making framework for commodity derivatives to improve liquidity
positive
LiveMint - Markets 32d ago

Sebi eyes market making framework for commodity derivatives to improve liquidity

Sebi is considering a market-making framework to boost liquidity in longer-dated commodity derivatives, helping businesses hedge future price risks more effectively. The move aims to reduce dependence on near-expiry contracts, improve price discovery and deepen India's commodity markets.

FELFELDVRFMNLConsumer ServicesServices
A new-age thirst for beverages is emerging as a key force in India's consumer goods market
positive
ET Markets - Industry 32d ago

A new-age thirst for beverages is emerging as a key force in India's consumer goods market

Beverage industry in India: Indian companies are seeing strong growth in drinks like coffee, ready-to-drink options, and protein beverages. Younger consumers are driving this trend, seeking convenience and health. Companies are expanding their offerings to meet this demand. This shift presents significant opportunities for future expansion in the Indian beverage market.

CONSUMEREVIETFEVINDIAFELFELDVRFMNLGROWWEVMEDANTAVINCOFEConsumer ServicesFinancial Services
Hotel giants bet India’s local travel boom can defy slowdown
positive
ET Markets - Industry 32d ago

Hotel giants bet India’s local travel boom can defy slowdown

Major hotel groups are investing heavily in India. They expect a surge in domestic travel to drive growth. This expansion continues despite economic concerns. Prime Minister Modi encourages local holidays. India's tourism market is set for significant expansion. New hotels are planned across the country. This signals a bright future for Indian hospitality.

CCHHLFELFELDVRFMNLINDHOTELIRCTCConsumer ServicesServices
Mid and smallcaps get the money as Nifty lags
positive
ET Markets - Stocks 32d ago

Mid and smallcaps get the money as Nifty lags

Investors are increasingly bullish on mid and small-cap stocks, reflecting a notable shift in market sentiment. The Advance-Decline Ratio has shown resilience for the past two months, leading to record highs in midcap and smallcap indices. Meanwhile, large-cap stocks are grappling with foreign selling pressure, suggesting that mid and small caps may continue to shine in the near future.

ADVANCEAONETMMQ50AONETOTALFELFELDVRFMNLGROWWMC150GROWWSC250HDFCMID150HDFCSML250LICNMID100MID150MID150BEESMID150CASEMIDCAPMIDCAPADDMIDCAPBETAMIDCAPETFMIDCAPIETFMIDQ50ADDMOCAPITALMOSMALL250SBINMID150SMALL250SMALLADDSMALLCAPSML100CASEChemicalsConsumer Services
India’s anti-obesity drug market sees slower growth after initial surge in generic semaglutide sales
positive
ET Markets - Industry 32d ago

India’s anti-obesity drug market sees slower growth after initial surge in generic semaglutide sales

India's anti-obesity drug market sees a slowdown after initial generic semaglutide sales. Demand has eased from its peak, with growth moderating. Doctors note that physician training and patient education are now crucial for future market expansion. Meanwhile, tirzepatide shows a recovery, maintaining its market position. Competition remains intense with numerous semaglutide brands.

FELFELDVRFMNLGLOBALINTENTECHConsumer ServicesInformation Technology
Titan Company shares gain 2%.  Why JPMorgan, others see up to 28% upside after analyst call?
positive
ET Markets - Stocks 36d ago

Titan Company shares gain 2%. Why JPMorgan, others see up to 28% upside after analyst call?

Titan shares are seeing gains as brokerages maintain a positive outlook. The company has outlined ambitious growth plans for the coming years. Key businesses like Tanishq are expected to see significant revenue and profit increases. Analysts highlight Titan's strong market position and ability to navigate challenges. Future growth is anticipated from both jewellery and other segments.

FELFELDVRFMNLTITANConsumer DurablesConsumer Services
Sensex rises over 200 points, Nifty above 23,400 as investors eye RBI MPC meet outcome
positive
ET Markets - Stocks 36d ago

Sensex rises over 200 points, Nifty above 23,400 as investors eye RBI MPC meet outcome

Indian stock markets are trading higher today. Sensex and Nifty are extending their gains for a second day. Investors are keenly watching the Reserve Bank of India's Monetary Policy Committee meeting. Market analysts expect the RBI to hold interest rates but signal future hikes. This policy decision will influence banking, auto, and real estate sectors.

ABRELABSLBANETFALPHAETFAONETMMQ50AONETOTALAUTOBEESAUTOIETFBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBNKETFAXISEBANKNIFTYFELFELDVRFINIETFFMNLGROWWCAPMGROWWN200GROWWPSUBKHDFCGROWTHHDFCNIFBANHDFCPSUBKHDFCPVTBANINDIANBIOBMOCAPITALMOM30IETFMOMENTUMMOMENTUM30MOMOMENTUMNIFTYQLITYNPBETPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDQUAL30IETFSETFNIFBKSOUTHBANKTRELConsumer ServicesFinancial Services
India plays large role in AI era of Windows: president Davuluri
positive
LiveMint - Companies 36d ago

India plays large role in AI era of Windows: president Davuluri

Windows chief Pavan Davuluri says India contributed significantly to the operating system’s new agentic AI capabilities and remains a priority market for future growth.

FELFELDVRFMNLConsumer ServicesServices
Mastercard to look beyond card biz; target tier 3 & 4 markets for growth
positive
ET Markets - Industry 37d ago

Mastercard to look beyond card biz; target tier 3 & 4 markets for growth

Mastercard is targeting India's expanding credit-on-UPI market. The company is looking beyond traditional card payments for future growth. Mastercard is focusing on new customer segments and underserved markets. They are also developing solutions for commercial payments. Mastercard aims to be part of all emerging payment technologies.

ALLETECFELFELDVRFMNLConsumer ServicesInformation Technology