Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:FELFinancial Services
Clear all filters
TVS Motor looking ahead with 'measured optimism': CMD Sudarshan Venu
positive
ET Markets - Industry 12d ago

TVS Motor looking ahead with 'measured optimism': CMD Sudarshan Venu

TVS Motor Company anticipates a complex yet exciting future, aiming to meet market expectations in India despite potential weather disruptions. The company achieved a record year in FY25-26, selling 5.89 million units and becoming the world's third-largest two-wheeler maker. With a strong focus on R&D and generative AI, TVS is investing heavily in electrification and connected technologies, solidifying its leadership in the growing electric two-wheeler segment.

FELFELDVRFMNLFOCUSTVSHLTDTVSMOTORAutomobile and Auto ComponentsConsumer Durables
Technology to be central to Hindustan Zinc's next phase of growth: Chairperson
positive
ET Markets - Industry 12d ago

Technology to be central to Hindustan Zinc's next phase of growth: Chairperson

Hindustan Zinc is pivoting towards becoming a future-ready energy transition company, Chairperson Priya Agarwal Hebbar announced. The firm is significantly investing in technology like AI and automation to boost productivity and safety. Diversifying beyond zinc, the company is exploring critical minerals such as lithium and rare earth elements, essential for the growing electric vehicle market and India's industrial expansion. This strategic shift, dubbed Hindustan Zinc 2.

AGARINDENERGYFELFELDVRFMNLGKENERGYHINDZINCKPELNRAILSARDAENChemicalsConstruction
Axis Bank CFO Puneet Sharma resigns to pursue new opportunities
positive
ET Markets - Industry 12d ago

Axis Bank CFO Puneet Sharma resigns to pursue new opportunities

Axis Bank's Chief Financial Officer, Puneet Sharma, has resigned to pursue new professional opportunities. Sharma, who has been with the bank since March 2020, will step down on August 31. He previously held significant roles at Tata Capital and Citibank. The bank expressed gratitude for his contributions and wished him well for the future.

AKCAPITAXISBANKBANKINDIABNKETFAXISCAPITALSFBCPCAPFELFELDVRJMFINANCILNAHARCAPNPBETTATACAPTATATECHConsumer ServicesFinancial Services
Industry experts chart the future of India’s bond and fixed income markets
positive
CNBC TV18 - Markets 13d ago

Industry experts chart the future of India’s bond and fixed income markets

India Fixed Income Summit brings meaningful conversations and fresh perspectives on India’s evolving bond market and the growing importance of fixed income in India’s financial ecosystem.

FELFELDVRFMNLJMFINANCILConsumer ServicesFinancial Services
The hidden reason global capital is looking beyond India for future growth
positive
ET Markets - Stocks 13d ago

The hidden reason global capital is looking beyond India for future growth

Foreign investors are reallocating capital away from India towards markets like Taiwan and South Korea that offer stronger exposure to AI and semiconductor growth. The trend highlights India’s structural gaps in innovation, limited deep-tech opportunities in listed markets, and rising concerns over valuations amid moderating earnings and slowing capital inflows.

AKCAPITARIHANTCAPCPCAPDEEPINDSECAPINSUREFELFELDVRGLOBALGROWWCAPMTECHZTECHConsumer ServicesFinancial Services
The hidden reason global capital is looking beyond India for future growth - The Economic Times
positive
Google News - India Markets 13d ago

The hidden reason global capital is looking beyond India for future growth - The Economic Times

The hidden reason global capital is looking beyond India for future growthThe Economic Times

AKCAPITCPCAPFELFELDVRGLOBALConsumer ServicesFinancial Services
Strides Pharma sells majority stake in arm Pivot Path for Rs 100 crore
positive
ET Markets - Industry 14d ago

Strides Pharma sells majority stake in arm Pivot Path for Rs 100 crore

Strides Pharma Science has divested a majority stake in its subsidiary, Pivot Path, for Rs 100 crore to a consortium led by Ascent Capital and Vintage Classic. This strategic move aims to accelerate Pivot Path's growth by infusing Rs 50 crore for future expansion. Strides will retain a 19.95% stake, while the investors will hold 65.05%. The transaction values Pivot Path at Rs 230 crore post-money.

AKCAPITCPCAPFELFELDVRSTARConsumer ServicesFinancial Services
Amber Group eyes $2 billion revenue milestone soon; invests Rs 6,750 crore in UP projects
positive
ET Markets - Industry 14d ago

Amber Group eyes $2 billion revenue milestone soon; invests Rs 6,750 crore in UP projects

Amber Group is poised to reach USD 2 billion in revenue soon, fueled by robust growth in its consumer durables, electronics, and railway/defence sectors. The company recently broke ground on a significant Rs 6,785 crore manufacturing expansion in Jewar, Uttar Pradesh. This includes a crucial PCB and semiconductor substrate unit via a joint venture, alongside an expanded air-conditioner complex, aiming for import substitution and future exports.

AMBERCONSUMERDEFENCEFELFELDVRHDFCGROWTHLGEINDIARPPINFRAConstructionConsumer Durables
Female entrepreneurs to drive deeper digital finance adoption says DBS Bank study, finds 84% already use payment tools
positive
ET Markets - Industry 14d ago

Female entrepreneurs to drive deeper digital finance adoption says DBS Bank study, finds 84% already use payment tools

Digital tools are becoming "increasingly integral to business management" for female entrepreneurs in India, supporting everything from payments and credit to payroll and future planning, according to DBS Bank India's latest Women and Finance study. The report saID sustaining this momentum will require "going beyond traditional banking to create connected ecosystems that help entrepreneurs at every stage of their business journey."

AUBANKBANKINDIACAPITALSFBEQUITASBNKESAFSFBFELFELDVRFINOPBFIVESTARJSFBLTFMOMENTUMSURYODAYUJJIVANSFBUTKARSHBNKConsumer ServicesFinancial Services
Female entrepreneurs to drive deeper digital finance adoption says DBS Bank study, finds 84% already use payment tools
positive
ET Markets - Industry 14d ago

Female entrepreneurs to drive deeper digital finance adoption says DBS Bank study, finds 84% already use payment tools

Digital tools are becoming "increasingly integral to business management" for female entrepreneurs in India, supporting everything from payments and credit to payroll and future planning, according to DBS Bank India's latest Women and Finance study. The report saID sustaining this momentum will require "going beyond traditional banking to create connected ecosystems that help entrepreneurs at every stage of their business journey."

AUBANKBANKINDIACAPITALSFBEQUITASBNKESAFSFBFELFELDVRFINOPBFIVESTARJSFBLTFMOMENTUMSURYODAYUJJIVANSFBUTKARSHBNKConsumer ServicesFinancial Services
Stocks to buy below  ₹100: Mehul Kothari of Anand Rathi recommends three shares to buy or sell
positive
LiveMint - Markets 14d ago

Stocks to buy below ₹100: Mehul Kothari of Anand Rathi recommends three shares to buy or sell

Next week, Bank Nifty's trading range is set between 57,000 and 59,000, with breakouts suggesting future trends. Analyst Mehul Kothari advises buying Trident, UCO Bank, and MMTC under ₹100, as the Indian market remains strong amid mixed signals and easing crude oil prices.

ABSLBANETFABSLNN50ETANANDRATHIAONETMMQ50AONETOTALARSSBLBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBNKETFAXISEBANKNIFTYESGFELFELDVRFINIETFFMNLGROWWNXT50GROWWPSUBKHDFCNEXT50HDFCNIF100HDFCNIFBANHDFCPSUBKHDFCPVTBANINDIANBIOBIOCJUNIORBEESLICNFNHGPLICNMID100LOWVOLLOWVOL1LOWVOLIETFMIDSMALLMMTCMOCAPITALMONEXT50MONIFTY100NEXT50NEXT50ADDNEXT50BETANEXT50ETFNEXT50IETFNIF100BEESNIF100IETFNIFTY100EWNPBETOILOILIETFPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDSETFNIFBKSETFNN50SMALLCAPSML100CASESOUTHBANKTOP100CASETRIDENTUCOBANKConsumer ServicesFinancial Services
Transrail Lighting Ltd secures overseas orders worth Rs 459 cr
positive
ET Markets - Industry 15d ago

Transrail Lighting Ltd secures overseas orders worth Rs 459 cr

Transrail Lighting Ltd has secured significant international orders totaling approximately Rs 459 crore, primarily for transmission line construction in the Middle East and North Africa. This boosts the company's total order inflow for the year to Rs 1,034 crore. Additionally, Transrail is the Lowest (L1) bidder for projects worth around Rs 400 crore, indicating a strong future pipeline and sustained growth prospects.

FELFELDVRGENCONMOGSECRPPINFRATOTALTRANSRAILLCapital GoodsConstruction