Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:KPELInformation Technology
Clear all filters
NEWS
positive
Business Standard - Markets 36d ago

INR appreciates under Rs 95 per dollar after RBI announces measures to support foreign capital inflows and strengthen forex liquidity

The Indian rupee appreciated 81 paise to close at 94.93 (provisional) against the US dollar on Friday after the Reserve Bank announced measures to support foreign capital inflows and strengthen forex liquidity. The announcements in the RBI policy boosted investor sentiments after the apex bank asserted that the country's forex reserves provide a sufficient buffer against external shocks. The Reserve Bank on Friday expectedly kept interest rates unchanged for the second time in a row as it weighed the impact of rising energy prices and supply disruptions caused by the West Asia crisis. The RBI kept its repo rate Steady at 5.25% amid uncertainty owing to US-Iran War. However, it expanded the Fully Accessible Route, or FAR, to include all new 15-year, 30-year and 40-year government security issuances. Due to this, the foreign investors will get wider access to longer-tenor Indian government bonds. This also opens up more room to invest in Indias bond market. The central bank has also ...

AKCAPITALLETECALLTIMEAPEXBANKINDIACAPITALSFBCENTRALBKCPCAPDOLLARENERGYGKENERGYIEXINDIANBIOBIREDAKPELMOCAPITALROUTESOUTHBANKConstructionConsumer Durables
NEWS
negative
Business Standard - Markets 36d ago

Jagran Prakashan Ltd leads losers in 'B' group

Suven Life Sciences Ltd, Ravindra Energy Ltd, Sunflag Iron & Steel Company Ltd and Exicom Tele-Systems Ltd are among the other losers in the BSE's 'B' group today, 05 June 2026.

ABSL10BANKALIVUSBGRENERGYBSEBSLSENETFGENERGYEXICOMGKENERGYJAGRANJFLLIFEJFL-REKPELRELTDRPGLIFERSYSTEMSSAILIFESALSTEELSUNFLAGSUVENSWELECTESVRAJCapital GoodsConstruction
Jain Irrigation, Ankur Scientific partner on agri waste-to-energy project in Maharashtra
positive
ET Markets - Industry 36d ago

Jain Irrigation, Ankur Scientific partner on agri waste-to-energy project in Maharashtra

Jain Irrigation Systems Ltd and Ankur Scientific are joining forces for a new project in Jalgaon, Maharashtra. This initiative will convert farm waste into thermal energy and biochar. Farmers will gain an extra income source from their crop residue. The plant will process nearly 50 tonnes of agricultural biomass daily.

BGRENERGYENERGYGKENERGYJISLDVREQSJISLJALEQSKPELPOLYSILRSYSTEMSSWELECTESCapital GoodsConstruction
NEWS
positive
Business Standard - Markets 36d ago

INR regains momentum with all eyes on RBI monetary policy

The Indian rupee is regaining some momentum in opening trades on Friday as the global crude oil prices eased and market participants keenly awaited the RBI's MPC decision today. Heightened geopolitical tensions between the US and Iran drove energy volatility and aggressive safe-haven buying capped sharp gains in the local unit. INR opened at Rs 95.72 per dollar and hit a high of 95.63 so far during the day. Yesterday, rupee depreciated 7 paise to close at 95.83 against the US dollar. Local markets opened in the green with investors closely watching the Reserve Bank of India (RBI) monetary policy announcement scheduled for today. The Indian benchmark indices are trading higher today, with the NIFTY 50 hovering around 23,442.30 (+0.11%) and the S&P BSE SENSEX trading at 74,556.68 (+0.26%).

ABSLBANETFADANIGREENALLETECALPL30IETFAONETMMQ50AONETOTALBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBNKETFAXISBSEBSLSENETFGDOLLAREBANKNIFTYECAPINSUREENERGYESENSEXFINIETFGILT10BETAGILT5BETAGILT5YBEESGKENERGYGLOBALGROWWCAPMGROWWLOVOLGROWWMOM50GROWWPSUBKGSEC10IETFGSEC5IETFHDFCNIFBANHDFCPSUBKHDFCPVTBANHDFCSENSEXIEXINDIANBINOXGREENIOBIOCIREDAKPELKPIGREENLOWVOLLOWVOL1LOWVOLIETFMIDSMALLMOCAPITALMOENERGYMOLOWVOLMOM30IETFMOMENTUMMOMENTUM30MOMENTUM50MOMIDMTMMOMOMENTUMNEXT30ADDNPBETNTPCGREENOILOILIETFPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDSAATVIKGLSBIBPBSBIMIDMOMSENSEXADDSENSEXAXISSENSEXBETASENSEXETFSENSEXIETFSETFNIFBKSMALLCAPSNXT30BEESSNXT50BETASOUTHBANKCapital GoodsConstruction
NEWS
positive
Business Standard - Markets 37d ago

Tata Power Company Ltd down for fifth straight session

Tata Power Company Ltd is quoting at Rs 411, down 0.18% on the day as on 13:19 IST on the NSE. The stock jumped 4.43% in last one year as compared to a 5.65% slide in NIFTY and a 12.98% spurt in the Nifty Energy index.

AONELIQUIDAONENIFTYAONETMMQ50AONETOTALBANKIETFDPELENERGYGKENERGYGVPILKPELMOENERGYNETFNPBETPVTBANIETFTATAPOWERTATATECHTNIDETFCapital GoodsConstruction
'India to pilot hydrogen buses, trucks on 10 roads; Reliance, Tata, NTPC among partners,' says Nitin Gadkari
positive
ET Markets - Industry 37d ago

'India to pilot hydrogen buses, trucks on 10 roads; Reliance, Tata, NTPC among partners,' says Nitin Gadkari

India is launching a pilot project for hydrogen-powered buses and trucks on ten roads. Major companies like Reliance and Tata are partnering in this initiative. The country aims to become an energy exporter, moving beyond imports. This marks a significant step in India's energy transition, with flex-fuel vehicles also set for expansion.

ENERGYGKENERGYKPELNTPCNTPCGREENRELIANCERELINFRATATATECHTMPVAutomobile and Auto ComponentsConstruction
Buy, Sell Or Hold: Suzlon Energy, TCS, Blue Star, Zen Tech, Kwality Walls — Ask Profit
positive
NDTV Profit 37d ago

Buy, Sell Or Hold: Suzlon Energy, TCS, Blue Star, Zen Tech, Kwality Walls — Ask Profit

Buy Sell Hold

BLUESTARCOENERGYGKENERGYKPELSTARSUZLONTCSTECHZENTECZTECHCapital GoodsConstruction
Maruti unveils India's first flex-fuel car: What is a flex fuel vehicle? How does it work? Will it cut your fuel bill? Here's all
positive
ET Markets - Industry 37d ago

Maruti unveils India's first flex-fuel car: What is a flex fuel vehicle? How does it work? Will it cut your fuel bill? Here's all

Maruti Suzuki has introduced India's first flex-fuel passenger car. This technology allows vehicles to run on petrol or petrol-ethanol blends. It is seen as a significant step towards reducing crude oil imports. The move also aims to lower carbon emissions and enhance India's energy security. This innovation could unlock substantial benefits for the country.

ALLETECENERGYGKENERGYKPELMARUTIOILOILCOUNTUBTMPVAutomobile and Auto ComponentsConstruction
Stocks in news: Rajesh Exports, Lenskart, Suzlon Energy, Aurobindo Pharma, Tata Motors
positive
ET Markets - Stocks 37d ago

Stocks in news: Rajesh Exports, Lenskart, Suzlon Energy, Aurobindo Pharma, Tata Motors

Indian markets saw volatility and closed lower on Wednesday. Key companies are in focus due to significant developments. SoftBank reduced its stake in Lenskart. Sebi issued an interim order against Rajesh Exports. Tata Motors revised its Avinya EV strategy. Suzlon Energy is diversifying into battery storage. RIL's subsidiary signed MoUs with the Haryana Government.

AUROPHARMAENERGYFOCUSGKENERGYIEXIREDAKPELLENSKARTRAJESHEXPOSUZLONTATATECHTMCVTMPVAutomobile and Auto ComponentsCapital Goods
Suzlon seeks to put the wind in all sails of its renewables ship
positive
ET Markets - Stocks 37d ago

Suzlon seeks to put the wind in all sails of its renewables ship

Suzlon Group is set to significantly expand its renewable energy business. The company aims to quadruple annual sales to 10 GW and grow managed assets to 70 GW by FY31. Suzlon will now offer integrated solutions including wind, solar, and battery storage. A new battery manufacturing facility is planned.

ALLETECENERGYGKENERGYIREDAKPELSOLARINDSSUZLONSWSOLARCapital GoodsChemicals
Suzlon seeks to put the wind in all sails of its renewables ship
positive
ET Markets - Industry 37d ago

Suzlon seeks to put the wind in all sails of its renewables ship

Suzlon Group is set to significantly expand its renewable energy business. The company aims to quadruple annual sales to 10 GW and grow managed assets to 70 GW by FY31. Suzlon will now offer integrated solutions including wind, solar, and battery storage. A new battery manufacturing facility is planned.

ALLETECENERGYGKENERGYIREDAKPELSOLARINDSSUZLONSWSOLARCapital GoodsChemicals
Ather Energy hits all-time high despite market selloff; what's fueling the rally? - Upstox
positive
Google News - India Markets 38d ago

Ather Energy hits all-time high despite market selloff; what's fueling the rally? - Upstox

Ather Energy hits all-time high despite market selloff; what's fueling the rally?Upstox

ALLETECALLTIMEATHERENERGENERGYGKENERGYKPELAutomobile and Auto ComponentsConstruction