Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:GKENERGYCapital Goods
Clear all filters
Five Stocks To Buy: Adani Energy, Adani Green, Gland Pharma And More | June 08, 2026
positive
NDTV Profit 5d ago

Five Stocks To Buy: Adani Energy, Adani Green, Gland Pharma And More | June 08, 2026

Top picks include power transmission major Adani Energy Solutions, renewable energy giant Adani Green Energy, pharma player Gland Pharma, automotive major Ashok Leyland, and carbon materials manufacturer Himadri Speciality Chemical.

ADANIENSOLADANIENTADANIGREENADANIPOWERAGNIASHOKLEYCHEMICALDPELENERGYGKENERGYGLANDGREENPOWERGVPILHIGREENHSCLINOXGREENIREDAKPELKPIGREENNTPCGREENOMPOWERPARAGONSAATVIKGLSDL26BEESSERVOTECHSPECIALITYSWSOLARCapital GoodsChemicals
Sops for private investors in nuclear energy on cards
positive
ET Markets - Industry 5d ago

Sops for private investors in nuclear energy on cards

The Indian government is actively seeking private sector investment for its nuclear energy expansion plans, aiming to boost green transition. Measures like assured power purchase agreements and potential financial support through schemes like RDI are being considered. Consultations with stakeholders will precede the roadmap for sustainable nuclear capacity development.

ADANIGREENAGNIBFINVESTDPELENERGYENERGYDEVGKENERGYGREENPOWERGVPILIEXINOXGREENIREDAJMFINANCILKPELKPIGREENNTPCGREENSAATVIKGLCapital GoodsConstruction
NTPC eyes low-load thermal units
positive
ET Markets - Industry 8d ago

NTPC eyes low-load thermal units

State-owned NTPC Ltd is seeking expressions of interest for developing thermal power units capable of operating at significantly lower loads, down to 25%. This move aims to enhance grid flexibility and support the integration of a growing share of variable renewable energy sources like solar and wind power.

DPELENERGYGKENERGYGVPILIREDAKPELNTPCNTPCGREENPOWERGRIDSERVOTECHSOLARINDSSWSOLARCapital GoodsChemicals
Adani Enterprises, Vodafone Idea among 6 stocks to hit 52-week high, rally up to 40% in a month
positive
ET Markets - Stocks 8d ago

Adani Enterprises, Vodafone Idea among 6 stocks to hit 52-week high, rally up to 40% in a month

Even as the Sensex fell 117 points to close at 74,243 on Friday, six BSE 200 stocks touched fresh 52-week highs. Vodafone Idea, Adani Enterprises, CG Power, Polycab India, Adani Energy Solutions and Federal Bank outperformed the broader market, signaling strong investor confidence and continued bullish momentum.

ADANIENSOLADANIENTADANIGREENADANIPOWERAONETMMQ50AXSENSEXBANKINDIABSEBSLSENETFGDPELENERGYEQUAL200ESENSEXFEDERALBNKGKENERGYGROWWPOWERGVPILHDFCSENSEXIDEAKPELMOM30IETFMOMENTUMMOMENTUM30MOMOMENTUMNEXT30ADDPOLYCABSBIBPBSENSEXADDSENSEXBETASENSEXETFSENSEXIETFSNXT30BEESSNXT50BETACapital GoodsConstruction
Top Gainers & Losers on June 5: Adani Green, Ather Energy, OLA, CarTrade Tech, YES Bank among top gainers
positive
LiveMint - Markets 8d ago

Top Gainers & Losers on June 5: Adani Green, Ather Energy, OLA, CarTrade Tech, YES Bank among top gainers

In terms of weekly performance, the Nifty 50 lost 0.8% of its value, extending its losing streak to a second straight week, while the Sensex also closed lower for the second consecutive week.

ABSLBANETFADANIENSOLADANIENTADANIGREENATHERENERGAXISBNKETFBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBIKEWOCARTRADEEBANKNIFTYENERGYFINIETFGKENERGYGROWWPSUBKHDFCNIFBANHDFCPSUBKHDFCPVTBANINOXGREENKPELKPIGREENMOENERGYNPBETNTPCGREENNV20NV20BEESPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDSAATVIKGLSDL26BEESSETFNIFBKTECHTOP10ADDTOP15IETFTOP20VALUEYESBANKZTECHAutomobile and Auto ComponentsCapital Goods
NEWS
negative
Business Standard - Markets 8d ago

Jagran Prakashan Ltd leads losers in 'B' group

Suven Life Sciences Ltd, Ravindra Energy Ltd, Sunflag Iron & Steel Company Ltd and Exicom Tele-Systems Ltd are among the other losers in the BSE's 'B' group today, 05 June 2026.

ABSL10BANKALIVUSBGRENERGYBSEBSLSENETFGENERGYEXICOMGKENERGYJAGRANJFLLIFEJFL-REKPELRELTDRPGLIFERSYSTEMSSAILIFESALSTEELSUNFLAGSUVENSWELECTESVRAJCapital GoodsConstruction
IFC commits USD 50 million to Hygenco to promote green hydrogen in India
positive
ET Markets - Industry 8d ago

IFC commits USD 50 million to Hygenco to promote green hydrogen in India

International Finance Corporation is investing USD 50 million in Hygenco Green Energies. This funding supports green hydrogen projects across India. The investment aims to scale up competitive green hydrogen supply for industries. Hygenco will develop projects and strengthen supply chains. This initiative will create jobs and support India's energy transition.

ADANIGREENBFINVESTCHOLAFINENERGYGKENERGYINOXGREENJPOLYINVSTKPELKPIGREENLTFMUFINNTPCGREENRPPINFRASAATVIKGLCapital GoodsConstruction
Jain Irrigation, Ankur Scientific partner on agri waste-to-energy project in Maharashtra
positive
ET Markets - Industry 8d ago

Jain Irrigation, Ankur Scientific partner on agri waste-to-energy project in Maharashtra

Jain Irrigation Systems Ltd and Ankur Scientific are joining forces for a new project in Jalgaon, Maharashtra. This initiative will convert farm waste into thermal energy and biochar. Farmers will gain an extra income source from their crop residue. The plant will process nearly 50 tonnes of agricultural biomass daily.

BGRENERGYENERGYGKENERGYJISLDVREQSJISLJALEQSKPELPOLYSILRSYSTEMSSWELECTESCapital GoodsConstruction
NEWS
positive
Business Standard - Markets 8d ago

Godawari Power & Ispat further invests Rs 100 cr in Godawari New Energy

DPELENERGYGKENERGYGPILGVPILKPELCapital GoodsConstruction
'Kudankulam Nuclear Power Plant now being constructed': Vladimir Putin sees India-Russia trade reaching USD 100 billion
positive
ET Markets - Industry 8d ago

'Kudankulam Nuclear Power Plant now being constructed': Vladimir Putin sees India-Russia trade reaching USD 100 billion

Speaking on the sidelines of the St Petersburg International Economic Forum on Thursday (local time) Putin said Moscow and New Delhi were aiming for more ambitious economic targets as trade between the two nations continues to grow. "We are not only talking about our plans in energy, including nuclear energy. Kudankulam Nuclear Power Plant (KKNPP) is now being constructed," he said.

DPELENERGYGKENERGYGVPILKPELNDTVCapital GoodsConstruction
Maruti Suzuki to invest Rs 925 crore by FY31 towards green energy initiatives
positive
ET Markets - Industry 8d ago

Maruti Suzuki to invest Rs 925 crore by FY31 towards green energy initiatives

Maruti Suzuki India Ltd announced a Rs 925 crore investment by FY 2030-31 for green energy, including two biogas projects. A new 10 TPD biogas plant will be set up at its Kharkhoda facility by FY 2026-27, while the Manesar plant's capacity has been expanded. These initiatives aim to reduce fossil fuel dependence and align with the government's 'Waste-to-Wealth' mission.

ADANIGREENBFINVESTEMMILENERGYGKENERGYINOXGREENKPELKPIGREENMARUTINTPCGREENRPPINFRASAATVIKGLWEALTHAutomobile and Auto ComponentsCapital Goods
NEWS
positive
Business Standard - Markets 8d ago

INR regains momentum with all eyes on RBI monetary policy

The Indian rupee is regaining some momentum in opening trades on Friday as the global crude oil prices eased and market participants keenly awaited the RBI's MPC decision today. Heightened geopolitical tensions between the US and Iran drove energy volatility and aggressive safe-haven buying capped sharp gains in the local unit. INR opened at Rs 95.72 per dollar and hit a high of 95.63 so far during the day. Yesterday, rupee depreciated 7 paise to close at 95.83 against the US dollar. Local markets opened in the green with investors closely watching the Reserve Bank of India (RBI) monetary policy announcement scheduled for today. The Indian benchmark indices are trading higher today, with the NIFTY 50 hovering around 23,442.30 (+0.11%) and the S&P BSE SENSEX trading at 74,556.68 (+0.26%).

ABSLBANETFADANIGREENALLETECALPL30IETFAONETMMQ50AONETOTALAXISBNKETFAXSENSEXBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBSEBSLSENETFGDOLLAREBANKNIFTYECAPINSUREENERGYESENSEXFINIETFGILT10BETAGILT5BETAGILT5YBEESGKENERGYGLOBALGROWWCAPMGROWWLOVOLGROWWMOM50GROWWPSUBKGSEC10IETFGSEC5IETFHDFCNIFBANHDFCPSUBKHDFCPVTBANHDFCSENSEXIEXINDIANBINOXGREENIOBIOCIREDAKPELKPIGREENLOWVOLLOWVOL1LOWVOLIETFMIDSMALLMOCAPITALMOENERGYMOLOWVOLMOM30IETFMOMENTUMMOMENTUM30MOMENTUM50MOMIDMTMMOMOMENTUMNEXT30ADDNPBETNTPCGREENOILOILIETFPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDSAATVIKGLSBIBPBSBIMIDMOMSENSEXADDSENSEXBETASENSEXETFSENSEXIETFSETFNIFBKSMALLCAPSNXT30BEESSNXT50BETASOUTHBANKCapital GoodsConstruction