Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:KPELChemicals
Clear all filters
India needs 2,000 GW new power capacity in 20 years, says Adani Green's Sagar Adani
positive
ET Markets - Industry 14d ago

India needs 2,000 GW new power capacity in 20 years, says Adani Green's Sagar Adani

India needs to add nearly 2,000 gigawatts of new power generation capacity over the next two decades to meet rising demand and reduce reliance on imported fuels, according to Adani Green Energy Executive Director Sagar Adani. He emphasized that electrification, supported by renewables, hydro, thermal, and nuclear power, is the clearest path to energy security, affordability, and sustainability for the nation.

ADANIENSOLADANIENTADANIGREENADANIPOWERAGNIDPELENERGYGKENERGYGREENPOWERGVPILINOXGREENKPELKPIGREENNTPCGREENRELIANCERELINFRARPOWERSAATVIKGLTECILCHEMCapital GoodsChemicals
NEWS
positive
Business Standard - Markets 14d ago

Power Grid commissions project for Solar Energy Zone in Ananthapur and Kurnool

Power Grid Corporation of India announced that project namely Transmission scheme for Solar Energy Zone in Ananthpuram (Ananthapur) (2500 MW) and Kurnool (1000 MW), Andhra Pradesh (Project) has been completely commissioned with effect from 24 June, 2026.

DPELENERGYGKENERGYGVPILKPELOMPOWERPOWERGRIDSOLARINDSCapital GoodsChemicals
Centre invites bids for green urea plants to curb import reliance
positive
ET Markets - Industry 15d ago

Centre invites bids for green urea plants to curb import reliance

The department on Friday held a pre-EoI meeting with public and private sector companies, including NTPC, the Solar Energy Corporation of India (SECI), fertiliser manufacturers, technology providers and green hydrogen developers, to discuss the proposed project framework.

ADANIGREENENERGYGKENERGYINOXGREENKPELKPIGREENNTPCNTPCGREENRELIANCERELINFRASAATVIKGLSOLARINDSCapital GoodsChemicals
Anti-dumping duty on electrical steel may push transformer costs, impact grid expansion: GTRI
positive
ET Markets - Industry 15d ago

Anti-dumping duty on electrical steel may push transformer costs, impact grid expansion: GTRI

A potential anti-dumping duty on crucial cold-rolled grain-oriented electrical steel (CRGO) imports could significantly hike transformer manufacturing costs and impede India's ambitious power grid expansion plans. With domestic production meeting less than 10% of demand, imposing duties might raise prices without reducing import reliance, impacting vital infrastructure development and renewable energy integration. The probe follows a complaint by JSW JFE Electrical Steel Nashik Pvt Ltd.

ABHAPOWERDPELENERGYENERGYDEVGKENERGYGVPILIREDAJSWENERGYJSWHLJSWINFRAJSWSTEELKPELMSPLPOWERGRIDQPOWERRELIANCERELINFRARPOWERSALSTEELSERVOTECHSWSOLARVITALCapital GoodsChemicals
NEWS
positive
Business Standard - Markets 15d ago

Clean Max Enviro Energy Solutions allots 41,120 equity shares under ESOS

Consequent to the aforesaid allotment, the paid-up share capital of the Company shall stand increased from Rs 11,71,75,990 to Rs 11,72,17,410.

AKCAPITCLEANCLEANMAXCPCAPENERGYENVIROGKENERGYKPELMAXINDCapital GoodsChemicals
Govt targets solar, hydrogen components to cut import dependence
positive
ET Markets - Industry 16d ago

Govt targets solar, hydrogen components to cut import dependence

India is boosting domestic manufacturing across solar, green hydrogen, and wind energy sectors to curb import reliance. Key focus areas include solar inverters, electrodes, catalysts, bipolar plates, and polysilicon. This strategic move aims to strengthen the supply chain for critical components, addressing current import dependencies and fostering long-term cost competitiveness for India's burgeoning renewable energy industry.

ADANIGREENBMETRICSCURRENTENERGYFOCUSGKENERGYINOXGREENIREDAKPELKPIGREENLTGILTBEESNTPCGREENRELIANCERELINFRASAATVIKGLSOLARINDSSWSOLARTVSSCSCapital GoodsChemicals
India, Iran revive energy dialogue as ministers meet on BRICS sidelines
positive
ET Markets - Industry 16d ago

India, Iran revive energy dialogue as ministers meet on BRICS sidelines

India and Iran are exploring new avenues for energy sector collaboration, as announced by Union Minister Hardeep Singh Puri following a meeting with his Iranian counterpart on the sidelines of the BRICS Energy Ministers’ Meeting. This engagement highlights India's ongoing commitment to bolstering its energy security through strategic partnerships with key producing nations. The discussions aimed at fostering mutually beneficial cooperation in the vital energy domain.

ENERGYGKENERGYKPELVITALChemicalsConstruction
Jupiter International Ltd invests Rs 550 cr in new TOPCon solar cell facility in Himachal's Baddi
positive
ET Markets - Industry 16d ago

Jupiter International Ltd invests Rs 550 cr in new TOPCon solar cell facility in Himachal's Baddi

Jupiter International Ltd has boosted its solar cell manufacturing capacity to 3.25 GW with a new 1.25 GW TOPCon unit in Himachal Pradesh, investing Rs 550 crore. This move signifies a shift towards advanced, high-efficiency solar technologies. The company's CEO highlighted this as a key step in their technology journey, paving the way for future expansions and supporting India's clean energy goals.

CLEANCLEANMAXENERGYFELFELDVRGKENERGYKPELSOLARINDSChemicalsConstruction
Sunsol mulls over 2 GW solar deployment through 5k projects in India by 2030
positive
ET Markets - Industry 16d ago

Sunsol mulls over 2 GW solar deployment through 5k projects in India by 2030

Global consultancy Sunkonnect's platform, Sunsol Cleantech, aims to deploy over two gigawatts of solar capacity in India by 2030. This initiative will support 5,000 projects, including rooftop and utility-scale installations, significantly contributing to India's ambitious 280 GW solar target. Sunsol's efforts are crucial for enhancing the nation's energy security, affordability, and sustainability, building on Sunkonnect's extensive experience in renewable energy.

ENERGYGKENERGYGLOBALIREDAKPELRPPINFRASOLARINDSSWSOLARChemicalsConstruction
India’s $55 billion green energy pipeline faces climate damage
positive
ET Markets - Industry 16d ago

India’s $55 billion green energy pipeline faces climate damage

India's ambitious renewable energy expansion faces a significant climate threat, with $55 billion in planned solar, wind, and hydropower assets vulnerable to extreme weather by 2030. Ninety percent of proposed capacity across ten states is at high risk from events like floods and wildfires. This highlights the urgent need for resilience measures to protect investments and ensure the nation's clean energy transition remains on track.

ADANIGREENCLEANCLEANMAXENERGYGKENERGYINOXGREENIREDAKPELKPIGREENNTPCGREENSAATVIKGLSOLARINDSSWSOLARCapital GoodsChemicals
30 India-bound ships cross Strait of Hormuz since Iran war began, 26 more await transit
positive
ET Markets - Industry 16d ago

30 India-bound ships cross Strait of Hormuz since Iran war began, 26 more await transit

Thirty ships bound for India have successfully navigated the Strait of Hormuz, a crucial route disrupted by recent geopolitical tensions. An additional 26 vessels are awaiting passage. Among those that transited, a significant portion carried vital energy supplies like LPG and LNG, alongside bulk cargo and crude oil. This development follows a recent agreement, easing concerns over energy imports for India.

ENERGYENERGYDEVGKENERGYIREDAKPELOILROUTEVITALChemicalsConstruction
NLC India bets big on green energy with 1,000 MW Odisha project
positive
CNBC TV18 - Markets 17d ago

NLC India bets big on green energy with 1,000 MW Odisha project

NLC India Renewables has partnered with OREDA to develop 1,000 MW of renewable energy projects in Odisha, as the state-run company accelerates its shift towards solar, wind, storage and green hydrogen.

ADANIGREENENERGYGKENERGYINOXGREENIREDAKPELKPIGREENNLCINDIANTPCGREENRPPINFRASAATVIKGLSOLARINDSSWSOLARCapital GoodsChemicals