Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:SWSOLARConstruction
Clear all filters
VOC Port emerges as model for sustainable maritime development
positive
ET Markets - Industry 17d ago

VOC Port emerges as model for sustainable maritime development

Leading the charge in India's sustainable maritime evolution, the V.O. Chidambaranar Port Authority (VOCPA) has made impressive strides in cutting carbon emissions and almost entirely covering its energy requirements with renewable resources. Union Minister Sarbananda Sonowal showcased these accomplishments during the launch of a new Kendriya Vidyalaya, highlighted an IIM Calcutta case study detailing the port's transition to greener practices, and introduced a new mobile app powered by generative AI.

ENERGYENERGYDEVGKENERGYIREDAKPELSWSOLARConstructionFinancial Services
CleanMax bets on big tech, data centres to power next phase of growth
positive
CNBC TV18 - Markets 17d ago

CleanMax bets on big tech, data centres to power next phase of growth

Clean Max Enviro Energy Solutions, India's largest commercial and industrial renewable energy provider, is positioning itself for strong growth as demand from big tech and data centres accelerates. With 3.1 GW of installed capacity and a 5.7 GW contracted portfolio, the company counts Meta, Google, Apple, Amazon and Equinix among its customers. CleanMax plans to add at least 1.5 GW in FY27 and 3 GW over three years, while aiming to double EBITDA. Analysts say its client-focused model and market leadership are difficult to replicate.

CGPOWERCLEANCLEANMAXDPELENERGYENVIROGKENERGYGVPILIREDAKPELMAXINDSERVOTECHSWSOLARTECHVIVIANAZTECHCapital GoodsChemicals
Banks boost renewable energy credit by 7% in April amid energy security concerns
positive
ET Markets - Industry 17d ago

Banks boost renewable energy credit by 7% in April amid energy security concerns

Banks are boosting credit to renewable energy projects, with a 7% jump in April, as global conflicts highlight India's reliance on oil. This surge in funding for green energy underscores the nation's commitment to energy transition. Experts note a growing demand for climate finance, urging banks to develop specialized underwriting for sunrise sectors like solar and green hydrogen, which are poised for significant growth.

ADANIGREENBBETF0432ENERGYGKENERGYGLOBALHDFCGROWTHINOXGREENIREDAKPELKPIGREENLTFMUFINNTPCGREENOILRELIANCERELINFRARHFLRPPINFRASAATVIKGLSOLARINDSSWSOLARCapital GoodsChemicals
NEWS
positive
Business Standard - Markets 17d ago

NLC India inks MoU with Indian Oil Corporation

NLC India has signed a memorandum of understanding (MoU) with Indian Oil Corporation (IOCL) for the formation of a joint venture for the establishment of renewable energy power projects in Tamil Nadu.

DPELENERGYGKENERGYGVPILIEXIOCIREDAKPELNLCINDIAOILPOWERMECHRPPINFRASERVOTECHSWSOLARTNPLCapital GoodsConstruction
FII-powered Suzlon Energy shares sit 15% below 52-week high. Will 2.0 roadmap deliver for 56 lakh investors?
positive
ET Markets - Stocks 17d ago

FII-powered Suzlon Energy shares sit 15% below 52-week high. Will 2.0 roadmap deliver for 56 lakh investors?

Suzlon Energy is attracting steady foreign investment despite market volatility, with FIIs increasing holdings for the third consecutive quarter. The company is transforming into a full-stack renewable energy solutions provider with an ambitious FY31 roadmap, targeting significant revenue growth and market share expansion. Brokerages are optimistic about its "Suzlon 2.0" strategy, focusing on integrated wind, solar, and storage solutions, though a Sebi order remains a concern.

ASMSBFINVESTENERGYGKENERGYIREDAKPELSOLARINDSSUZLONSWSOLARCapital GoodsChemicals
India nears 50% domestic coal use in import-based power plants, sources say
positive
ET Markets - Industry 18d ago

India nears 50% domestic coal use in import-based power plants, sources say

India is significantly boosting the use of domestic coal at power plants previously reliant on imports, aiming to slash costly overseas purchases. Over 50% of capacity at these plants is now running on local fuel, with trials expanding this further. This shift is enabled by increased renewable energy generation freeing up domestic supplies and plant modifications to handle local coal's higher ash content.

COALINDIADPELENERGYGKENERGYGVPILIREDAKPELSERVOTECHSWSOLARCapital GoodsConstruction
NLC India shares in focus after firm signs renewable energy projects MoU with Indian Oil - Upstox
positive
Google News - India Markets 18d ago

NLC India shares in focus after firm signs renewable energy projects MoU with Indian Oil - Upstox

NLC India shares in focus after firm signs renewable energy projects MoU with Indian OilUpstox

ENERGYFOCUSGKENERGYIEXIOCIREDAKPELNLCINDIAOILRPPINFRASWSOLARConstructionConsumer Durables
NEWS
positive
Business Standard - Markets 18d ago

NLC India signs MoU with Indian Oil Corporation

For incorporation of a renewable energy JV

ENERGYGKENERGYIEXIOCIREDAKPELNLCINDIAOILSWSOLARConstructionFinancial Services
NLC India, Indian Oil Corporation partner up for large-scale green energy projects
positive
ET Markets - Industry 18d ago

NLC India, Indian Oil Corporation partner up for large-scale green energy projects

State-run NLC India Limited (NLCIL) has partnered with Indian Oil Corporation Limited (IOC) to form a joint venture focused on developing large-scale green energy projects in Tamil Nadu. This collaboration, formalized by a Memorandum of Understanding, aims to advance renewable energy initiatives including solar, wind, and storage solutions. The partnership signifies a strategic move for NLCIL's diversification into clean energy and contributes to India's sustainable development goals.

ADANIGREENADVANCECLEANCLEANMAXENERGYENERGYDEVGKENERGYIEXINOXGREENIOCIREDAKPELKPIGREENNLCINDIANTPCGREENOILRPPINFRASAATVIKGLSOLARINDSSWSOLARTNPLCapital GoodsChemicals
Interarch Building Solutions bags ₹165 crore order; June order wins reach ₹375 crore
positive
CNBC TV18 - Markets 18d ago

Interarch Building Solutions bags ₹165 crore order; June order wins reach ₹375 crore

Interarch said it has secured new orders worth approximately ₹375 crore during June 2026, including the ₹165-crore contract from the energy sector in Vadodara, along with projects from the hydrocarbon, farm equipment, electrical products, renewable energy and data centre industries.

ENERGYGKENERGYINDOFARMINTERARCHIREDAKPELRPPINFRASHANKARASWSOLARCapital GoodsConstruction
Sterling & Wilson Renewable shares jump 7% on reports of $560 million Egypt solar project win - Upstox
positive
Google News - India Markets 18d ago

Sterling & Wilson Renewable shares jump 7% on reports of $560 million Egypt solar project win - Upstox

Sterling & Wilson Renewable shares jump 7% on reports of $560 million Egypt solar project winUpstox

SOLARINDSSWSOLARWEWINChemicalsConstruction
NEWS
positive
Business Standard - Markets 18d ago

Belding India forms JV with HD Fabcon to foray into renewable energy domain

Belding India said that it has incorporated a subsidiary company namely Belding HD India in joint venture with HD Fabcon, with shareholding structure of 55% and 45%, respectively.

ENERGYGKENERGYIREDAKPELSWSOLARConstructionFinancial Services