Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:MOMENTUMConsumer Services
Clear all filters
US-Iran talks, oil movement to drive bullion trend next week: Analysts
negative
Business Standard - Markets 20d ago

US-Iran talks, oil movement to drive bullion trend next week: Analysts

Developments surrounding US-Iran negotiations, movement in crude oil prices and key global economic data are expected to steer gold and silver prices next week, analysts said. The focus will squarely be on talks scheduled in Burgenstock, Switzerland, where US Vice President J D Vance is expected to lead discussions with Iranian officials to build on last week's framework agreement aimed at ending hostilities and reviving nuclear negotiations. Analysts said the outcome of the talks could influence risk sentiment and energy markets, with implications for bullions. Domestic commodity markets will remain closed during the morning session on Friday on account of Muharram. "Gold and silver momentum looks sideways/corrective as focus will remain on the negotiation between Washington and Tehran and also on the flow of crude oil, LNG and raw materials from the Strait of Hormuz," Pranav Mer, Vice President, EBG - Commodity & Currency Research, JM Financial Services Ltd, said. The precious .

ENERGYFOCUSGKENERGYGLOBALJMFINANCILKPELMOMENTUMOILSILVERConstructionConsumer Durables
Easing West Asia tensions boost IPO activity, 3 issues to open next week
positive
Business Standard - Markets 20d ago

Easing West Asia tensions boost IPO activity, 3 issues to open next week

The primary market is showing signs of revival as improving geopolitical conditions in West Asia have boosted investor sentiment, prompting three mainboard IPO launches next week and paving the way for more public issues in the pipeline. Cordelia Cruises operator Waterways Leisure Tourism, Jaipur-based jewellery manufacturer Advit Jewels, and IT solutions provider CSM Technologies will launch their maiden public issues over the next few days, while packaging solutions provider Knack Packaging is expected to announce its price band. Quick commerce unicorn Zepto is looking to raise over Rs 10,000 crore, and the country's largest fund house, SBI Mutual Fund, plans to launch its Rs 13,000-crore public issue next month, according to people familiar with the development. In June, CMR Green Technologies and Hexagon Nutrition have already launched their IPOs, while the public issue of insurtech unicorn Turtlemint Fintech Solutions is currently underway. Adding to the momentum, the National

ABSLPSEALPHAALPHAETFAONEGOLDAONELIQUIDAONENIFTYAONESILVERAONETMMQ50AONETOTALAUTOBEESAUTOIETFAXISBPSETFBANK10ADDBANKADDBANKBETFBANKETFBANKPSUBBETF0432BBNPNBETFBBNPPGOLDBFSIBNKETFAXISCHEMICALCHOICEGOLDCMRGREENCOMMOIETFCONSUMAXISDEFENCEDIVIDENDEBANKNIFTYEBBETF0430EBBETF0431EBBETF0433ECAPINSUREEGOLDELIQUIDELM250ENERGYENIFTYEQUAL200EQUAL50EQUAL50ADDESENSEXESGESILVERFINIETFFLEXIADDFMCGADDFMCGIETFGILT10BETAGILT5BETAGOLD1GOLD360GOLDADDGOLDAXISGOLDBETAGOLDBNDGOLDCASEGOLDETFGROWWCAPMGROWWCHEMGROWWDEFNCGROWWEVGROWWGOLDGROWWHOSPIGROWWLIQIDGROWWLOVOLGROWWMC150GROWWMETALGROWWMOM50GROWWN200GROWWNETGROWWNIFTYGROWWNXT50GROWWPOWERGROWWPSEGROWWPSUBKGROWWRAILGROWWRLTYGROWWSC250GROWWSLVRGSEC10IETFGSEC10YEARHDFCGOLDHDFCGROWTHHDFCLOWVOLHDFCMID150HDFCMOMENTHDFCNEXT50HDFCNIF100HDFCNIFITHDFCPSUBKHDFCPVTBANHDFCQUALHDFCSILVERHDFCSML250HDFCVALUEHEALTHADDHEALTHAXISHEALTHCAREHEALTHIETFHEXAGONHSBCGOLDICICIB22INFRAIETFINTERNETITADDITAXISITBEESITBETAITDCITETFITIETFLICNETFSENLICNMID100LIQGRWBEESLIQUIDLIQUID1LIQUIDCASELIQUIDPLUSLIQUIDSBILIQUIDSHRILOWVOLLTGILTCASEMAFANGMAHKTECHMAKEINDIAMANUFGBEESMASPTOP50METALMETALIETFMID150MID150CASEMIDCAPADDMIDCAPBETAMIDCAPETFMIDCAPIETFMIDQ50ADDMNCMOALPHA50MOBANK10MOCAPITALMODEFENCEMOENERGYMOGOLDMOGSECMOHEALTHMOINFRAMOIPOMOLOWVOLMOM100MOM30IETFMOM50MOMENTUMMOMENTUM30MOMENTUM50MOMGFMOMIDMTMMOMNCMOMOMENTUMMON100MON50EQUALMONEXT50MONIFTY100MONIFTY500MONQ50MOPSEMOQUALITYMOREALTYMOSERVICEMOSILVERMOSMALL250MOTOURMOVALUEMSCIADDMSCIINDIAMULTICAPNEXT30ADDNEXT50NEXT50ADDNEXT50BETANEXT50ETFNEXT50IETFNIFTY100EWNIFTYADDNIFTYAXISNIFTYBETFNIFTYCASENIFTYETFNIFTYQLITYOILIETFPHARMABEESPOLICYBZRPSUBANKADDPSUBNKIETFPVTBANKADDQUALITY30SBIBPBSBIETFCONSBIETFITSBIETFPBSBIETFQLTYSBILIQETFSBIMIDMOMSBINEQWETFSBINMID150SBISILVERSELECTIPOSENSEXAXISSENSEXETFSETF10GILTSETFNN50SILVERSILVER1SILVER360SILVERADDSILVERAGSILVERAXISSILVERBEESSILVERBETASILVERBNDSILVERCASESILVERIETFSMALL250SMALLADDSML100CASESNXT30BEESTATAGOLDTATSILVTECHTNIDETFTOP100CASETOP10ADDTOP20TWCGOLDETFUNIONGOLDVAL30IETFVALUEVALUEAXISCapital GoodsConsumer Services
Hindalco appoints Kapil Agrawal as CEO (Designate) for copper business; Rohit Pathak to move to new role
positive
CNBC TV18 - Markets 23d ago

Hindalco appoints Kapil Agrawal as CEO (Designate) for copper business; Rohit Pathak to move to new role

Hindalco Industries has appointed Kapil Agrawal as CEO (Designate) – Copper with effect from November 1, 2026. He will take over as CEO of the Copper business from March 1, 2027, succeeding Rohit Pathak, who will transition to a new role within the Aditya Birla Group.

ABCAPITALABFRLABGSECABLBLABRELABSL10BANKABSLAMCABSLBANETFABSLLIQUIDABSLNN50ETABSLPSEBIRLACORPNBIRLAMONEYBSLGOLDETFBSLNIFTYBSLSENETFGGSEC10ABSLHEALTHYHINDALCOMOMENTUMNIFTYQLITYSILVERTAKETECHConstruction MaterialsConsumer Services
Siemens Energy among 3 stocks flash bullish signals, indicating possible uptrend
positive
ET Markets - Stocks 23d ago

Siemens Energy among 3 stocks flash bullish signals, indicating possible uptrend

Three NSE largecap stocks, including Siemens Energy India, Trent, and Hindustan Aeronautics, showed bullish momentum on April 27 by forming a White Marubozu pattern, according to StockEdge data. The pattern indicates strong buying interest throughout the session and is often seen by traders as a signal of a potential upward trend.

ENERGYENRINGKENERGYHALKPELMOMENTUMSIEMENSTRENTCapital GoodsConstruction
Defence shares gain momentum on strong production and growth outlook
positive
ET Markets - Stocks 24d ago

Defence shares gain momentum on strong production and growth outlook

Indian defence stocks surged as the government announced a record ₹1.78 lakh crore in defence production for fiscal 2026, a 15.6% increase from the previous year. This growth, driven by policy push and rising global demand, has led to a strong rally in defence companies and the Nifty Defence Index, which is up 23% year-to-date.

AONELIQUIDAONETMMQ50AXISBPSETFBANKIETFDEFENCEGLOBALGROWWDEFNCGROWWMOM50HDFCGROWTHHDFCLIQUIDLIQGRWBEESLIQUIDBETFLIQUIDPLUSMIDSMALLMODEFENCEMOGSECMOM30IETFMOMENTUMMOMENTUM30MOMENTUM50MOMIDMTMMOMOMENTUMPVTBANIETFSBILIQETFSBIMIDMOMSDL26BEESSMALLCAPConsumer ServicesFinancial Services
Here's why Godrej Properties, Lodha and shares of other Mumbai-based realtors could be under pressure
positive
CNBC TV18 - Markets 24d ago

Here's why Godrej Properties, Lodha and shares of other Mumbai-based realtors could be under pressure

Barring Oberoi Realty, which is up 2% for the year, the shares of the other Mumbai-based realtors are down anywhere between 10.5% (Godrej Properties), to as much as 22% (Aditya Birla Real Estate). Shares of Keystone Realtors are down 26% year-to-date, while Mahindra Lifespaces shares are also down 13% for 2026 so far.

ABCAPITALABFRLABGSECABLBLABRELABSL10BANKABSLAMCABSLBANETFABSLLIQUIDABSLNN50ETABSLPSEBIRLACORPNBIRLAMONEYBSLGOLDETFBSLNIFTYBSLSENETFGGODREJINDGODREJPROPGSEC10ABSLHEALTHYLODHAM&MMOMENTUMNIFTYQLITYOBEROIRLTYRUSTOMJEESILVERTECHTRELAutomobile and Auto ComponentsConstruction Materials
Markets poised for a cautious start as GIFT Nifty ticks higher
positive
ET Markets - Stocks 25d ago

Markets poised for a cautious start as GIFT Nifty ticks higher

Indian markets continued their upward trend on Tuesday. The Nifty closed at 23,989. Analysts anticipate this positive momentum to persist. Improved geopolitical situations, increased foreign investor interest, and falling crude oil prices are driving the market. A potential US-Iran peace agreement is boosting global sentiment. The India VIX, a fear index, saw a decline.

AONETMMQ50AONETOTALBANKIETFGLOBALGROWWCAPMGROWWMOM50IOCMIDSMALLMOCAPITALMOM30IETFMOMENTUMMOMENTUM30MOMENTUM50MOMIDMTMMOMOMENTUMOILOILIETFPVTBANIETFSBIMIDMOMSMALLCAPConsumer ServicesFinancial Services
Nutrition brand TruNativ raises $30 million funding led by OrbiMed, eyes global expansion
positive
LiveMint - Companies 25d ago

Nutrition brand TruNativ raises $30 million funding led by OrbiMed, eyes global expansion

Protein as a category has been gaining momentum in India, with 2,672 nutrition-focused food startups currently operating in the country.

GLOBALMOMENTUMConsumer ServicesFinancial Services
Global rally bypasses India as IPO momentum fades and foreign investors turn cautious. What lies ahead for markets? - Business Today
positive
Google News - India Markets 25d ago

Global rally bypasses India as IPO momentum fades and foreign investors turn cautious. What lies ahead for markets? - Business Today

Global rally bypasses India as IPO momentum fades and foreign investors turn cautious. What lies ahead for markets?Business Today

GLOBALMOMENTUMConsumer ServicesFinancial Services
NEWS
neutral
Business Standard - Markets 25d ago

ABFRL's Sangeeta Tanwani steps down as Pantaloons CEO

Aditya Birla Fashion and Retail (ABFRL) said Sangeeta Tanwani has ceased to be whole-time director (WTD) and chief executive officer (CEO) of its Pantaloons business with effect from close of business hours on 31 July 2026.

ABCAPITALABFRLABGSECABLBLABRELABSL10BANKABSLAMCABSLBANETFABSLLIQUIDABSLNN50ETABSLPSEBELLACASABIRLACORPNBIRLAMONEYBSLGOLDETFBSLNIFTYBSLSENETFGGOCOLORSGSEC10ABSLHEALTHYMOMENTUMNIFTYQLITYRETAILSDREAMSSILVERTECHV2RETAILConstruction MaterialsConsumer Services
Nifty closing above 23,800 positive but exhaustion visible at 24,000
positive
CNBC TV18 - Markets 26d ago

Nifty closing above 23,800 positive but exhaustion visible at 24,000

The benchmark index gained 231 points to close at 23,853. After opening with a gap-up of 362 points on strong global cues, Nifty hit its intraday high within minutes of the opening bell. However, the momentum faded through the day as profit-booking emerged at higher levels, dragging the index nearly 200 points lower from its peak before it settled with healthy gains.

ALPHAETFAONETMMQ50BANKIETFGILT10BETAGILT5BETAGILT5YBEESGLOBALGROWWMOM50GROWWN200GSEC10IETFGSEC5IETFHEALTHYMIDSMALLMOM30IETFMOMENTUMMOMENTUM30MOMENTUM50MOMIDMTMMOMOMENTUMNIFTYQLITYPVTBANIETFQUAL30IETFSBIMIDMOMSMALLCAPConsumer ServicesFinancial Services
Sensex Today | Nifty 50 | Stock Market Live Updates: Sensex zooms over 850 pts, Nifty above 23,850; realt... - The Economic Times
positive
Google News - India Markets 26d ago

Sensex Today | Nifty 50 | Stock Market Live Updates: Sensex zooms over 850 pts, Nifty above 23,850; realt... - The Economic Times

Sensex Today | Nifty 50 | Stock Market Live Updates: Sensex zooms over 850 pts, Nifty above 23,850; realt...The Economic TimesIndian shares join global rally on Gulf peace dealReutersSensex Today | Stock Market Live: Sensex up 860 pts, Nifty above 23,850; MTAR Tech, HDFC Bank, IFCI most activeMoneycontrol.comIndian stocks, rupee rally as crude oil prices drop on West Asia peace deal announcementThe Indian ExpressStock Market Live June 15: Sensex rises 900 points, Nifty tops 23,900; rupee gains on Iran-US deal optimismBusinessLineStock Market LIVE: Sensex off 400 pts from day's high; Nifty below 23,950; Ashoka Buildcon jumps 14%Business StandardSensex jumps 1,200 points: Why is stock market rising today?India TodayFrom Gift Nifty, US-Iran peace deal to crude oil prices: 10 key things that changed for Indian stock market over weekendMintSensex Today Rallies 1,695 Points | Nifty Above 23,600 | 4 Reasons Why Indian Share Markets Are RisingEquitymaster

ABSLBANETFALPHAETFAONETMMQ50AONETOTALARSSBLASHOKABANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBNKETFAXISEBANKNIFTYFINIETFGLOBALGROWWCAPMGROWWN200GROWWPSUBKGULFOILLUBHDFCBANKHDFCGROWTHHDFCLIQUIDHDFCMID150HDFCNEXT50HDFCNIF100HDFCNIFBANHDFCNIFITHDFCNIFTYHDFCPSUBKHDFCPVTBANHDFCSENSEXHDFCSML250IFCIINDIANBIOBIOCMOCAPITALMOM30IETFMOMENTUMMOMENTUM30MOMOMENTUMMTARTECHNIFTYQLITYNPBETOILOILIETFPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDQUAL30IETFSETFNIFBKSOUTHBANKTECHZTECHCapital GoodsConstruction