Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:FELDVRServices
Clear all filters
Air India Express defers Noida Airport launch, exits Hindon amid cost-cutting
positive
ET Markets - Industry 32d ago

Air India Express defers Noida Airport launch, exits Hindon amid cost-cutting

Air India Express has indefinitely postponed its operations from Noida International Airport. This reduces the number of airlines launching services at the new airport next week. IndiGo will start services on opening day, followed by Akasa Air. Air India Group is focusing on cost reduction. Hindon Airport traffic has declined significantly. Stakeholders remain optimistic about future growth.

FELFELDVRINDIGOConsumer ServicesServices
Sebi eyes market making framework for commodity derivatives to improve liquidity
positive
LiveMint - Markets 32d ago

Sebi eyes market making framework for commodity derivatives to improve liquidity

Sebi is considering a market-making framework to boost liquidity in longer-dated commodity derivatives, helping businesses hedge future price risks more effectively. The move aims to reduce dependence on near-expiry contracts, improve price discovery and deepen India's commodity markets.

FELFELDVRFMNLConsumer ServicesServices
A new-age thirst for beverages is emerging as a key force in India's consumer goods market
positive
ET Markets - Industry 32d ago

A new-age thirst for beverages is emerging as a key force in India's consumer goods market

Beverage industry in India: Indian companies are seeing strong growth in drinks like coffee, ready-to-drink options, and protein beverages. Younger consumers are driving this trend, seeking convenience and health. Companies are expanding their offerings to meet this demand. This shift presents significant opportunities for future expansion in the Indian beverage market.

CONSUMEREVIETFEVINDIAFELFELDVRFMNLGROWWEVMEDANTAVINCOFEConsumer ServicesFinancial Services
Hotel giants bet India’s local travel boom can defy slowdown
positive
ET Markets - Industry 32d ago

Hotel giants bet India’s local travel boom can defy slowdown

Major hotel groups are investing heavily in India. They expect a surge in domestic travel to drive growth. This expansion continues despite economic concerns. Prime Minister Modi encourages local holidays. India's tourism market is set for significant expansion. New hotels are planned across the country. This signals a bright future for Indian hospitality.

CCHHLFELFELDVRFMNLINDHOTELIRCTCConsumer ServicesServices
Mid and smallcaps get the money as Nifty lags
positive
ET Markets - Stocks 33d ago

Mid and smallcaps get the money as Nifty lags

Investors are increasingly bullish on mid and small-cap stocks, reflecting a notable shift in market sentiment. The Advance-Decline Ratio has shown resilience for the past two months, leading to record highs in midcap and smallcap indices. Meanwhile, large-cap stocks are grappling with foreign selling pressure, suggesting that mid and small caps may continue to shine in the near future.

ADVANCEAONETMMQ50AONETOTALFELFELDVRFMNLGROWWMC150GROWWSC250HDFCMID150HDFCSML250LICNMID100MID150MID150BEESMID150CASEMIDCAPMIDCAPADDMIDCAPBETAMIDCAPETFMIDCAPIETFMIDQ50ADDMOCAPITALMOSMALL250SBINMID150SMALL250SMALLADDSMALLCAPSML100CASEChemicalsConsumer Services
India’s anti-obesity drug market sees slower growth after initial surge in generic semaglutide sales
positive
ET Markets - Industry 33d ago

India’s anti-obesity drug market sees slower growth after initial surge in generic semaglutide sales

India's anti-obesity drug market sees a slowdown after initial generic semaglutide sales. Demand has eased from its peak, with growth moderating. Doctors note that physician training and patient education are now crucial for future market expansion. Meanwhile, tirzepatide shows a recovery, maintaining its market position. Competition remains intense with numerous semaglutide brands.

FELFELDVRFMNLGLOBALINTENTECHConsumer ServicesInformation Technology
HC quashes ₹23,600 cr retrospective spectrum dues on Airtel, Voda Idea
neutral
ET Markets - Industry 33d ago

HC quashes ₹23,600 cr retrospective spectrum dues on Airtel, Voda Idea

The Bombay High Court has cancelled spectrum charges of approximately 23,600 crore rupees for Bharti Airtel and Vodafone Idea. The court ruled the government could not retrospectively impose these charges for the period between 2008 and 2012. This decision removes significant financial uncertainty for the telecom sector. It creates a more supportive environment for future investments in India's telecommunications industry.

BHARTIARTLFELFELDVRHPTLIDEAJMFINANCILSPECTRUMCapital GoodsConsumer Services
Electric mobility key to long-term fight against air pollution: UNEP chief
positive
ET Markets - Industry 36d ago

Electric mobility key to long-term fight against air pollution: UNEP chief

A top UN official stresses electric mobility and mandatory vehicle emissions testing for long-term air pollution solutions. India's plan to phase out older commercial vehicles with cleaner alternatives is highlighted. Investment in clean public transport and cleaner cooking solutions is crucial. Addressing local pollution sources like construction dust and waste burning is also vital for a healthier future.

BFINVESTCLEANFELFELDVRLTGILTBEESOLAELECTCITENNINDVICTORYEVVITALZFCVINDIAAutomobile and Auto ComponentsChemicals
Titan Company shares gain 2%.  Why JPMorgan, others see up to 28% upside after analyst call?
positive
ET Markets - Stocks 36d ago

Titan Company shares gain 2%. Why JPMorgan, others see up to 28% upside after analyst call?

Titan shares are seeing gains as brokerages maintain a positive outlook. The company has outlined ambitious growth plans for the coming years. Key businesses like Tanishq are expected to see significant revenue and profit increases. Analysts highlight Titan's strong market position and ability to navigate challenges. Future growth is anticipated from both jewellery and other segments.

FELFELDVRFMNLTITANConsumer DurablesConsumer Services
Sensex rises over 200 points, Nifty above 23,400 as investors eye RBI MPC meet outcome
positive
ET Markets - Stocks 36d ago

Sensex rises over 200 points, Nifty above 23,400 as investors eye RBI MPC meet outcome

Indian stock markets are trading higher today. Sensex and Nifty are extending their gains for a second day. Investors are keenly watching the Reserve Bank of India's Monetary Policy Committee meeting. Market analysts expect the RBI to hold interest rates but signal future hikes. This policy decision will influence banking, auto, and real estate sectors.

ABRELABSLBANETFALPHAETFAONETMMQ50AONETOTALAUTOBEESAUTOIETFBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBNKETFAXISEBANKNIFTYFELFELDVRFINIETFFMNLGROWWCAPMGROWWN200GROWWPSUBKHDFCGROWTHHDFCNIFBANHDFCPSUBKHDFCPVTBANINDIANBIOBMOCAPITALMOM30IETFMOMENTUMMOMENTUM30MOMOMENTUMNIFTYQLITYNPBETPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDQUAL30IETFSETFNIFBKSOUTHBANKTRELConsumer ServicesFinancial Services
India plays large role in AI era of Windows: president Davuluri
positive
LiveMint - Companies 37d ago

India plays large role in AI era of Windows: president Davuluri

Windows chief Pavan Davuluri says India contributed significantly to the operating system’s new agentic AI capabilities and remains a priority market for future growth.

FELFELDVRFMNLConsumer ServicesServices
Mastercard to look beyond card biz; target tier 3 & 4 markets for growth
positive
ET Markets - Industry 38d ago

Mastercard to look beyond card biz; target tier 3 & 4 markets for growth

Mastercard is targeting India's expanding credit-on-UPI market. The company is looking beyond traditional card payments for future growth. Mastercard is focusing on new customer segments and underserved markets. They are also developing solutions for commercial payments. Mastercard aims to be part of all emerging payment technologies.

ALLETECFELFELDVRFMNLConsumer ServicesInformation Technology