Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:FELConsumer Services
Clear all filters
The hidden reason global capital is looking beyond India for future growth - The Economic Times
positive
Google News - India Markets 13d ago

The hidden reason global capital is looking beyond India for future growth - The Economic Times

The hidden reason global capital is looking beyond India for future growthThe Economic Times

AKCAPITCPCAPFELFELDVRGLOBALConsumer ServicesFinancial Services
The hidden reason global capital is looking beyond India for future growth
positive
ET Markets - Stocks 13d ago

The hidden reason global capital is looking beyond India for future growth

Foreign investors are reallocating capital away from India towards markets like Taiwan and South Korea that offer stronger exposure to AI and semiconductor growth. The trend highlights India’s structural gaps in innovation, limited deep-tech opportunities in listed markets, and rising concerns over valuations amid moderating earnings and slowing capital inflows.

AKCAPITARIHANTCAPCPCAPDEEPINDSECAPINSUREFELFELDVRGLOBALGROWWCAPMTECHZTECHConsumer ServicesFinancial Services
Strides Pharma sells majority stake in arm Pivot Path for Rs 100 crore
positive
ET Markets - Industry 14d ago

Strides Pharma sells majority stake in arm Pivot Path for Rs 100 crore

Strides Pharma Science has divested a majority stake in its subsidiary, Pivot Path, for Rs 100 crore to a consortium led by Ascent Capital and Vintage Classic. This strategic move aims to accelerate Pivot Path's growth by infusing Rs 50 crore for future expansion. Strides will retain a 19.95% stake, while the investors will hold 65.05%. The transaction values Pivot Path at Rs 230 crore post-money.

AKCAPITCPCAPFELFELDVRSTARConsumer ServicesFinancial Services
Amber Group eyes $2 billion revenue milestone soon; invests Rs 6,750 crore in UP projects
positive
ET Markets - Industry 14d ago

Amber Group eyes $2 billion revenue milestone soon; invests Rs 6,750 crore in UP projects

Amber Group is poised to reach USD 2 billion in revenue soon, fueled by robust growth in its consumer durables, electronics, and railway/defence sectors. The company recently broke ground on a significant Rs 6,785 crore manufacturing expansion in Jewar, Uttar Pradesh. This includes a crucial PCB and semiconductor substrate unit via a joint venture, alongside an expanded air-conditioner complex, aiming for import substitution and future exports.

AMBERCONSUMERDEFENCEFELFELDVRHDFCGROWTHLGEINDIARPPINFRAConstructionConsumer Durables
Female entrepreneurs to drive deeper digital finance adoption says DBS Bank study, finds 84% already use payment tools
positive
ET Markets - Industry 14d ago

Female entrepreneurs to drive deeper digital finance adoption says DBS Bank study, finds 84% already use payment tools

Digital tools are becoming "increasingly integral to business management" for female entrepreneurs in India, supporting everything from payments and credit to payroll and future planning, according to DBS Bank India's latest Women and Finance study. The report saID sustaining this momentum will require "going beyond traditional banking to create connected ecosystems that help entrepreneurs at every stage of their business journey."

AUBANKBANKINDIACAPITALSFBEQUITASBNKESAFSFBFELFELDVRFINOPBFIVESTARJSFBLTFMOMENTUMSURYODAYUJJIVANSFBUTKARSHBNKConsumer ServicesFinancial Services
Female entrepreneurs to drive deeper digital finance adoption says DBS Bank study, finds 84% already use payment tools
positive
ET Markets - Industry 14d ago

Female entrepreneurs to drive deeper digital finance adoption says DBS Bank study, finds 84% already use payment tools

Digital tools are becoming "increasingly integral to business management" for female entrepreneurs in India, supporting everything from payments and credit to payroll and future planning, according to DBS Bank India's latest Women and Finance study. The report saID sustaining this momentum will require "going beyond traditional banking to create connected ecosystems that help entrepreneurs at every stage of their business journey."

AUBANKBANKINDIACAPITALSFBEQUITASBNKESAFSFBFELFELDVRFINOPBFIVESTARJSFBLTFMOMENTUMSURYODAYUJJIVANSFBUTKARSHBNKConsumer ServicesFinancial Services
Stocks to buy below  ₹100: Mehul Kothari of Anand Rathi recommends three shares to buy or sell
positive
LiveMint - Markets 14d ago

Stocks to buy below ₹100: Mehul Kothari of Anand Rathi recommends three shares to buy or sell

Next week, Bank Nifty's trading range is set between 57,000 and 59,000, with breakouts suggesting future trends. Analyst Mehul Kothari advises buying Trident, UCO Bank, and MMTC under ₹100, as the Indian market remains strong amid mixed signals and easing crude oil prices.

ABSLBANETFABSLNN50ETANANDRATHIAONETMMQ50AONETOTALARSSBLBANKADDBANKBEESBANKBETABANKBETFBANKETFBANKIETFBANKINDIABANKNIFTY1BANKPSUBBNPNBETFBNKETFAXISEBANKNIFTYESGFELFELDVRFINIETFFMNLGROWWNXT50GROWWPSUBKHDFCNEXT50HDFCNIF100HDFCNIFBANHDFCPSUBKHDFCPVTBANINDIANBIOBIOCJUNIORBEESLICNFNHGPLICNMID100LOWVOLLOWVOL1LOWVOLIETFMIDSMALLMMTCMOCAPITALMONEXT50MONIFTY100NEXT50NEXT50ADDNEXT50BETANEXT50ETFNEXT50IETFNIF100BEESNIF100IETFNIFTY100EWNPBETOILOILIETFPSUBANKPSUBANKADDPSUBNKBEESPSUBNKIETFPVTBANIETFPVTBANKADDSETFNIFBKSETFNN50SMALLCAPSML100CASESOUTHBANKTOP100CASETRIDENTUCOBANKConsumer ServicesFinancial Services
Transrail Lighting Ltd secures overseas orders worth Rs 459 cr
positive
ET Markets - Industry 15d ago

Transrail Lighting Ltd secures overseas orders worth Rs 459 cr

Transrail Lighting Ltd has secured significant international orders totaling approximately Rs 459 crore, primarily for transmission line construction in the Middle East and North Africa. This boosts the company's total order inflow for the year to Rs 1,034 crore. Additionally, Transrail is the Lowest (L1) bidder for projects worth around Rs 400 crore, indicating a strong future pipeline and sustained growth prospects.

FELFELDVRGENCONMOGSECRPPINFRATOTALTRANSRAILLCapital GoodsConstruction
Noida airport to triple flights from July; IndiGo to lead major expansion
positive
ET Markets - Industry 15d ago

Noida airport to triple flights from July; IndiGo to lead major expansion

Noida International Airport is set to significantly boost its flight operations from July 1, increasing from 12 to around 45 daily services connecting 16-17 destinations. Following an initial period to iron out system glitches, the airport is expanding its network to include major cities like Mumbai and Srinagar. While facing challenges with cab fares and public transport, NIA is preparing for international operations by year-end and future terminal expansion.

FELFELDVRINDIGOTCIConsumer ServicesServices
Tata Motors PV is on a clear road. JLR remains the speed bump.
positive
LiveMint - Markets 15d ago

Tata Motors PV is on a clear road. JLR remains the speed bump.

The carmaker has laid out an ambitious domestic growth roadmap, but investors remain focused on Jaguar Land Rover's recovery as the key driver of future stock performance.

3PLANDFELFELDVRTATATECHTMCVTMPVAutomobile and Auto ComponentsCapital Goods
NEWS
positive
Business Standard - Markets 15d ago

Aether Industries commences commercial operations at Panoli manufacturing Site 5

First phase of the new facility begins operations from 26 June 2026; company expects capacity expansion to support future revenue growth.

AETHERFELFELDVRChemicalsConsumer Services
Adani Ports emerges top contender for Karanja Terminal takeover
positive
ET Markets - Stocks 16d ago

Adani Ports emerges top contender for Karanja Terminal takeover

Adani Ports is poised to acquire Karanja Terminal & Logistics, with creditors endorsing its ₹625-crore recovery plan. The nation's top port operator has offered full repayment to financial creditors for their outstanding dues. This development follows Prudent ARC's acquisition of nearly all of Karanja's debt, signaling a significant shift in the company's future.

ADANIENTADANIPORTSALLETECBRACEPORTFELFELDVRJMFINANCILPRUDENTSJLOGISTICConsumer ServicesFinancial Services